BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021880 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 93 1e-19 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 88 4e-18 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 88 6e-18 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 88 6e-18 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 82 4e-16 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 71 5e-13 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 54 1e-07 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 53 2e-07 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 44 7e-05 At5g64970.1 68418.m08172 mitochondrial substrate carrier family ... 44 1e-04 At3g55640.1 68416.m06182 mitochondrial substrate carrier family ... 43 2e-04 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 43 2e-04 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 42 3e-04 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 42 5e-04 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 41 6e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 41 8e-04 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 40 0.001 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 40 0.001 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 38 0.008 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 38 0.008 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 37 0.010 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 37 0.010 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 37 0.013 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 36 0.018 At4g27940.1 68417.m04009 mitochondrial substrate carrier family ... 36 0.031 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 36 0.031 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 36 0.031 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 35 0.041 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 35 0.041 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 35 0.041 At4g24570.1 68417.m03521 mitochondrial substrate carrier family ... 35 0.054 At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 34 0.095 At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) id... 34 0.095 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 34 0.095 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 33 0.13 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 33 0.13 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 33 0.13 At2g34720.1 68415.m04264 CCAAT-binding transcription factor (CBF... 32 0.29 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 32 0.29 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 31 0.51 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 31 0.88 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 30 1.2 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 30 1.5 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 30 1.5 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 29 2.0 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 29 2.0 At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA... 29 2.7 At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA... 29 2.7 At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA... 29 2.7 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 29 2.7 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 29 2.7 At4g22590.1 68417.m03259 trehalose-6-phosphate phosphatase, puta... 29 3.6 At2g21040.1 68415.m02495 C2 domain-containing protein low simila... 29 3.6 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 28 4.7 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 28 4.7 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 28 4.7 At5g26200.1 68418.m03118 mitochondrial substrate carrier family ... 28 6.2 At1g71680.1 68414.m08271 lysine and histidine specific transport... 28 6.2 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 93.5 bits (222), Expect = 1e-19 Identities = 46/85 (54%), Positives = 60/85 (70%), Gaps = 1/85 (1%) Frame = +1 Query: 256 ERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 ERVKLL+Q Q + K + YKGI D F R K++G+L+ WRGN ANVIRYFPTQALN Sbjct: 101 ERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALN 160 Query: 433 FAFKDKYKQVFLGGVDKKTQFWRYF 507 FAFKD +K++F +K +W++F Sbjct: 161 FAFKDYFKRLF-NFKKEKDGYWKWF 184 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/34 (58%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Frame = +3 Query: 543 TSLCFVYPLDFARTRLAAD--VGKGDGQREFSGL 638 +SL FVY LD+ARTRLA D K GQR+F+G+ Sbjct: 197 SSLLFVYSLDYARTRLANDAKAAKKGGQRQFNGM 230 Score = 35.1 bits (77), Expect = 0.041 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 191 FAKDFLAGGISAAVSKTAVAP 253 F DFL GG+SAAVSKTA AP Sbjct: 79 FLIDFLMGGVSAAVSKTAAAP 99 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 471 +YK + AF +I K +G S ++G AN++R + A DK + + LG Sbjct: 321 KYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGAGV-LAGYDKLQLIVLG 371 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 88.2 bits (209), Expect = 4e-18 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 1/85 (1%) Frame = +1 Query: 256 ERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 ERVKLL+Q Q + K + YKGI D F R +++G+ S WRGN ANVIRYFPTQALN Sbjct: 106 ERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALN 165 Query: 433 FAFKDKYKQVFLGGVDKKTQFWRYF 507 FAFKD +K++F D K +W++F Sbjct: 166 FAFKDYFKRLFNFKKD-KDGYWKWF 189 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = +3 Query: 543 TSLCFVYPLDFARTRLAAD---VGKGDGQREFSGL 638 +SL FVY LD+ARTRLA D KG G+R+F+GL Sbjct: 202 SSLLFVYSLDYARTRLANDSKSAKKGGGERQFNGL 236 Score = 36.3 bits (80), Expect = 0.018 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +2 Query: 191 FAKDFLAGGISAAVSKTAVAP 253 FA DF+ GG+SAAVSKTA AP Sbjct: 84 FAIDFMMGGVSAAVSKTAAAP 104 Score = 31.5 bits (68), Expect = 0.51 Identities = 18/72 (25%), Positives = 33/72 (45%) Frame = +1 Query: 292 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 471 +K+ ++++ G+VD + + K G+ +RG + + L F D K V L Sbjct: 224 AKKGGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLLT 283 Query: 472 GVDKKTQFWRYF 507 G D + F+ F Sbjct: 284 G-DLQDSFFASF 294 Score = 31.1 bits (67), Expect = 0.67 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 408 +YK DAF +I K++G S ++G AN++R Sbjct: 327 KYKSSFDAFSQIVKKEGAKSLFKGAGANILR 357 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 87.8 bits (208), Expect = 6e-18 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 1/85 (1%) Frame = +1 Query: 256 ERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 ERVKLL+Q Q + K + YKGI D F R K++G S WRGN ANVIRYFPTQALN Sbjct: 102 ERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN 161 Query: 433 FAFKDKYKQVFLGGVDKKTQFWRYF 507 FAFKD +K++F D + +W++F Sbjct: 162 FAFKDYFKRLFNFKKD-RDGYWKWF 185 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/35 (60%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = +3 Query: 543 TSLCFVYPLDFARTRLAAD---VGKGDGQREFSGL 638 +SL FVY LD+ARTRLA D KG G R+F GL Sbjct: 198 SSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGL 232 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +2 Query: 191 FAKDFLAGGISAAVSKTAVAP 253 FA DFL GG+SAAVSKTA AP Sbjct: 80 FALDFLMGGVSAAVSKTAAAP 100 Score = 31.1 bits (67), Expect = 0.67 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 408 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 Score = 30.7 bits (66), Expect = 0.88 Identities = 18/72 (25%), Positives = 33/72 (45%) Frame = +1 Query: 292 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 471 +K+ +++ G+VD + + K G+ +RG + + + L F D K V L Sbjct: 220 AKKGGGGRQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLT 279 Query: 472 GVDKKTQFWRYF 507 G D + F+ F Sbjct: 280 G-DLQDSFFASF 290 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 87.8 bits (208), Expect = 6e-18 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 1/85 (1%) Frame = +1 Query: 256 ERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 ERVKLL+Q Q + K + YKGI D F R K++G S WRGN ANVIRYFPTQALN Sbjct: 102 ERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN 161 Query: 433 FAFKDKYKQVFLGGVDKKTQFWRYF 507 FAFKD +K++F D + +W++F Sbjct: 162 FAFKDYFKRLFNFKKD-RDGYWKWF 185 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/35 (60%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = +3 Query: 543 TSLCFVYPLDFARTRLAAD---VGKGDGQREFSGL 638 +SL FVY LD+ARTRLA D KG G R+F GL Sbjct: 198 SSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGL 232 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +2 Query: 191 FAKDFLAGGISAAVSKTAVAP 253 FA DFL GG+SAAVSKTA AP Sbjct: 80 FALDFLMGGVSAAVSKTAAAP 100 Score = 31.1 bits (67), Expect = 0.67 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 408 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 Score = 30.7 bits (66), Expect = 0.88 Identities = 18/72 (25%), Positives = 33/72 (45%) Frame = +1 Query: 292 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 471 +K+ +++ G+VD + + K G+ +RG + + + L F D K V L Sbjct: 220 AKKGGGGRQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLT 279 Query: 472 GVDKKTQFWRYF 507 G D + F+ F Sbjct: 280 G-DLQDSFFASF 290 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 81.8 bits (193), Expect = 4e-16 Identities = 45/85 (52%), Positives = 58/85 (68%), Gaps = 1/85 (1%) Frame = +1 Query: 256 ERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 ERVKLLLQ Q + K + Y G+ + F RI +E+G+LSFWRGN ANVIRYFPTQA N Sbjct: 32 ERVKLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEGVLSFWRGNQANVIRYFPTQASN 91 Query: 433 FAFKDKYKQVFLGGVDKKTQFWRYF 507 FAFK +K + LG +K + ++F Sbjct: 92 FAFKGYFKNL-LGCSKEKDGYLKWF 115 Score = 31.9 bits (69), Expect = 0.38 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = +3 Query: 543 TSLCFVYPLDFARTRLAADVGK--GDGQREFSGL 638 T+ F+Y LD+ARTRL D + +G+R+F G+ Sbjct: 128 TTSLFLYHLDYARTRLGTDAKECSVNGKRQFKGM 161 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 71.3 bits (167), Expect = 5e-13 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 6/75 (8%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQ------RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 417 ER KLLLQ Q + I D+ R+KG+ D R +E+G+LS WRGN ++V+RY+P Sbjct: 52 ERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRTVREEGVLSLWRGNGSSVLRYYP 111 Query: 418 TQALNFAFKDKYKQV 462 + ALNF+ KD Y+ + Sbjct: 112 SVALNFSLKDLYRSI 126 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +3 Query: 543 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCIS 653 T+L VYPLD A TRLAAD+GK + R+F G+ + +S Sbjct: 154 TALIVVYPLDIAHTRLAADIGKPEA-RQFRGIHHFLS 189 Score = 32.3 bits (70), Expect = 0.29 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF-LGGV 477 Y+ +D + +I + +GL SF+RG +N+ R + A+ F D+ K+ GG+ Sbjct: 278 YRSTLDCWKKIYRSEGLASFYRGALSNMFRSTGSAAI-LVFYDEVKRFLNWGGI 330 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/76 (31%), Positives = 41/76 (53%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 +R+KLL+Q + + ++ G ++A I KE+G+ +W+GN VIR P A+ Sbjct: 109 DRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLPYSAVQL 168 Query: 436 AFKDKYKQVFLGGVDK 483 + YK +F G D+ Sbjct: 169 LAYESYKNLFKGKDDQ 184 Score = 31.9 bits (69), Expect = 0.38 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 462 YK I +AF I GL+ +RG N ++ P ++ D K++ Sbjct: 312 YKSIPEAFAGIIDRDGLIGLYRGFLPNALKTLPNSSIRLTTFDMVKRL 359 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/65 (24%), Positives = 33/65 (50%) Frame = +1 Query: 298 QIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGV 477 ++A + RY+ + + + +++G+ SF+ G +++ P A+NF D K+ Sbjct: 214 RLAVEPRYRTMSQVALSMLRDEGIASFYYGLGPSLVGIAPYIAVNFCIFDLVKKSLPEEY 273 Query: 478 DKKTQ 492 KK Q Sbjct: 274 RKKAQ 278 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 52.8 bits (121), Expect = 2e-07 Identities = 24/72 (33%), Positives = 40/72 (55%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 +R+KLL+Q V + ++ G ++A I KE+G+ +W+GN VIR P A+ Sbjct: 137 DRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGIKGYWKGNLPQVIRIVPYSAVQL 196 Query: 436 AFKDKYKQVFLG 471 + YK++F G Sbjct: 197 FAYETYKKLFRG 208 Score = 31.9 bits (69), Expect = 0.38 Identities = 15/58 (25%), Positives = 30/58 (51%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQ 492 YK ++DAF I +G++ +RG N ++ P ++ D K++ + +K+ Q Sbjct: 340 YKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIVKKL-IAASEKEIQ 396 Score = 30.7 bits (66), Expect = 0.88 Identities = 16/65 (24%), Positives = 33/65 (50%) Frame = +1 Query: 298 QIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGV 477 ++A + Y+ + + + +E+G+ SF+ G +++ P A+NF D K+ Sbjct: 242 RLAVEPGYRTMSQVALNMLREEGVASFYNGLGPSLLSIAPYIAINFCVFDLVKKSLPEKY 301 Query: 478 DKKTQ 492 +KTQ Sbjct: 302 QQKTQ 306 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 349 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL--GGVDKKTQFWRY 504 I QGL FW+GN NV+R P +A+NF D Y++ L G + T F R+ Sbjct: 92 IATTQGLTGFWKGNLLNVLRTAPFKAVNFCAYDTYRKQLLKIAGNQEATNFERF 145 >At5g64970.1 68418.m08172 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 428 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = +1 Query: 328 IVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK-QVF-LGGVDKKTQFWR 501 +++ RI +G+ FW+GN N++R P +++NF D Y+ Q+ L G ++ T F R Sbjct: 168 LLELIQRIATNEGIRGFWKGNLVNILRTAPFKSINFYAYDTYRGQLLKLSGNEETTNFER 227 Query: 502 Y 504 + Sbjct: 228 F 228 >At3g55640.1 68416.m06182 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 332 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/67 (34%), Positives = 35/67 (52%) Frame = +1 Query: 259 RVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 438 R+ +L QVQ + AA R I+ RI E+GL +FW+GN + P ++NF Sbjct: 57 RLTILFQVQGMHTNAAA-LRKPSILHEASRILNEEGLKAFWKGNLVTIAHRLPYSSVNFY 115 Query: 439 FKDKYKQ 459 + YK+ Sbjct: 116 AYEHYKK 122 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +1 Query: 313 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 474 + YK +VDA RI +++G+ S WRG++ V R A A D K++ + G Sbjct: 187 RNYKSVVDAIDRIARQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAG 240 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%) Frame = +1 Query: 256 ERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 ER+K+L Q + K+I G+V + +I K +GL+ F+RGN A+V R P AL+ Sbjct: 39 ERIKILFQTRRDEFKRI-------GLVGSINKIGKTEGLMGFYRGNGASVARIVPYAALH 91 Query: 433 FAFKDKYKQVFLGGVDKKTQ 492 + ++Y++ + G T+ Sbjct: 92 YMAYEEYRRWIIFGFPDTTR 111 Score = 38.7 bits (86), Expect = 0.003 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +1 Query: 259 RVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 R KL Q Q K I +Q Y+GIVD F R +E G +RG ++ FP L F Sbjct: 138 RTKLAYQTQ--VKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAGLKF 195 Query: 436 AFKDKYKQ 459 F ++ K+ Sbjct: 196 YFYEEMKR 203 Score = 33.1 bits (72), Expect = 0.17 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +2 Query: 191 FAKDFLAGGISAAVSKTAVAP 253 FAK+ +AGG++ ++KTAVAP Sbjct: 17 FAKELIAGGVTGGIAKTAVAP 37 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 41.5 bits (93), Expect = 5e-04 Identities = 23/66 (34%), Positives = 34/66 (51%) Frame = +1 Query: 259 RVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 438 R+ +L Q+Q + + AA I RI KE+G +FW+GN V P A+NF Sbjct: 92 RLTILFQIQGMQSE-AAILSSPNIWHEASRIVKEEGFRAFWKGNLVTVAHRLPYGAVNFY 150 Query: 439 FKDKYK 456 ++YK Sbjct: 151 AYEEYK 156 Score = 35.1 bits (77), Expect = 0.041 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 468 Y+G+ AF I +E+G+L ++G A ++ P+ A++FA + +K +L Sbjct: 213 YQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAISFAAYETFKTFWL 262 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 41.1 bits (92), Expect = 6e-04 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = +1 Query: 292 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 462 S + +D +YKG +D F +I +++G WRG A++ PT + D ++ + Sbjct: 91 SASVCSDNQYKGTLDVFYKIIRQEGFSRLWRGTNASLTLAIPTVGIYMPCYDYFRNI 147 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 40.7 bits (91), Expect = 8e-04 Identities = 24/63 (38%), Positives = 34/63 (53%) Frame = +1 Query: 262 VKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAF 441 VK L Q S+ RYKG+V A I E+GL++ WRG ++R P QA+ +A Sbjct: 234 VKTRLMAQ--SRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRIPPGQAIMWAV 291 Query: 442 KDK 450 D+ Sbjct: 292 ADQ 294 Score = 31.1 bits (67), Expect = 0.67 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +1 Query: 256 ERVKLLLQVQH-VSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 E VK+ LQ Q +S ++ +YKG + I +E+ +L W G V+R QA+ Sbjct: 130 EVVKIRLQQQKGLSPELF---KYKGPIHCARTIVREESILGLWSGAAPTVMRNGTNQAVM 186 Query: 433 FAFKDKY 453 F K+ + Sbjct: 187 FTAKNAF 193 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/75 (34%), Positives = 39/75 (52%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 +R+K+ LQVQ + G+V +I +E LL F+RGN NV + P A+ F Sbjct: 226 DRLKVALQVQRTNL---------GVVPTIKKIWREDKLLGFFRGNGLNVAKVAPESAIKF 276 Query: 436 AFKDKYKQVFLGGVD 480 A + K + +GG D Sbjct: 277 AAYEMLKPI-IGGAD 290 Score = 30.7 bits (66), Expect = 0.88 Identities = 13/60 (21%), Positives = 31/60 (51%) Frame = +1 Query: 280 VQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 459 +Q + ++ AD + F++ + +GL F+RG F N + P+ ++++ + K+ Sbjct: 414 LQVIRTRMQADSSKTSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKK 473 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 AKDFLAGGISAAVSKTAVAP 253 +K LAGGI+ AVS+TA AP Sbjct: 205 SKLLLAGGIAGAVSRTATAP 224 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/69 (33%), Positives = 35/69 (50%) Frame = +1 Query: 259 RVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 438 R+ +L Q+Q + + A R +A RI E+G +FW+GN V+ P A+NF Sbjct: 64 RLTILFQLQGMQSEGAVLSRPNLRREAS-RIINEEGYRAFWKGNLVTVVHRIPYTAVNFY 122 Query: 439 FKDKYKQVF 465 +KY F Sbjct: 123 AYEKYNLFF 131 Score = 33.9 bits (74), Expect = 0.095 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 456 Y+GI F I +E+G+L ++G A ++ P+ A+NFA + K Sbjct: 185 YQGIEHTFRTICREEGILGLYKGLGATLLGVGPSLAINFAAYESMK 230 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 197 KDFLAGGISAAVSKTAVAP 253 ++ LAGGI+ A+SKT AP Sbjct: 43 QNLLAGGIAGAISKTCTAP 61 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 37.5 bits (83), Expect = 0.008 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +1 Query: 289 VSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 468 V ++ +Y G+V A I +E+G FWRGN ++ P ++ F K K F Sbjct: 59 VRGNLSGASKYTGMVQATKDIFREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKS-FA 117 Query: 469 GGVDK 483 G K Sbjct: 118 SGSTK 122 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 37.5 bits (83), Expect = 0.008 Identities = 19/79 (24%), Positives = 39/79 (49%) Frame = +1 Query: 253 HERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN 432 HE ++ LQ Q + A+ +Y G++D ++ + +G+ +RG N++R P+ + Sbjct: 238 HEVIRAKLQEQGQIRN--AETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVIT 295 Query: 433 FAFKDKYKQVFLGGVDKKT 489 F + + F V +T Sbjct: 296 FTTYEMMLRFFRQVVPPET 314 Score = 33.9 bits (74), Expect = 0.095 Identities = 21/67 (31%), Positives = 32/67 (47%) Frame = +1 Query: 262 VKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAF 441 +K LQV + + A+ QR I+ + I KE+G +RG +I P A+ F+ Sbjct: 41 IKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNWAVYFSV 100 Query: 442 KDKYKQV 462 K K V Sbjct: 101 YGKLKDV 107 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 465 YKGI DAF++I +E+G +RG ++I P A N+ D ++ + Sbjct: 239 YKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAATNYFAYDSLRKAY 287 Score = 31.1 bits (67), Expect = 0.67 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 334 DAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN-FAFKDKYKQV 462 + F I K +G +RGN NVIR P +A+ F F+ K++ Sbjct: 149 EVFSDIMKHEGWTGLFRGNLVNVIRVAPARAVELFVFETVNKKL 192 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/50 (22%), Positives = 28/50 (56%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 468 YK ++ A V I + +G+L +++G + ++ P ++F + K++ + Sbjct: 337 YKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGISFMCYEACKKILI 386 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 37.1 bits (82), Expect = 0.010 Identities = 22/71 (30%), Positives = 38/71 (53%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 ER+K+LLQ + D + G+ + ++ + G L F++GN A+VIR P AL++ Sbjct: 45 ERIKILLQTR------TNDFKTLGVSQSLKKVLQFDGPLGFYKGNGASVIRIIPYAALHY 98 Query: 436 AFKDKYKQVFL 468 + Y+ L Sbjct: 99 MTYEVYRDWIL 109 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 149 T*SNKMSNLADPV-AFAKDFLAGGISAAVSKTAVAP 253 T S + +L D + AK +AGG + A++KTAVAP Sbjct: 8 TLSADVMSLVDTLPVLAKTLIAGGAAGAIAKTAVAP 43 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 ER+K+LLQVQ+ + +Y G V I + +GL ++GN N R P A+ F Sbjct: 60 ERMKILLQVQNPH-----NIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVKF 114 Score = 32.3 bits (70), Expect = 0.29 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +1 Query: 307 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 462 A Y G+VDAF + + +G + ++G N ++ P+ A+ F + K V Sbjct: 292 ASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDV 343 Score = 31.9 bits (69), Expect = 0.38 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 456 +Y+GI A + +E+G + +RG +VI P LNF+ + K Sbjct: 179 QYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSVYESLK 225 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 188 AFAKDFLAGGISAAVSKTAVAP 253 + K AGG++ VS+TAVAP Sbjct: 37 SICKSLFAGGVAGGVSRTAVAP 58 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 36.3 bits (80), Expect = 0.018 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK 483 +Y G+ I +E+GL FWRGN ++ P ++ FA K K F G K Sbjct: 63 KYNGLFRTTKDIFREEGLSGFWRGNVPALLMVVPYTSIQFAVLHKVKS-FAAGSSK 117 >At4g27940.1 68417.m04009 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 413 Score = 35.5 bits (78), Expect = 0.031 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 456 +YKG D F +I +++GL WRG A + P + F D ++ Sbjct: 145 QYKGTFDVFTKIIRQEGLGRLWRGTNAGLALAVPMVGIYLPFYDMFR 191 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 35.5 bits (78), Expect = 0.031 Identities = 21/69 (30%), Positives = 34/69 (49%) Frame = +1 Query: 262 VKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAF 441 VK+ LQ + A +RY G ++A+ I +++G+ + W G NV R A A Sbjct: 138 VKVRLQAEG-KLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELAS 196 Query: 442 KDKYKQVFL 468 D+ K+ L Sbjct: 197 YDQVKETIL 205 Score = 31.5 bits (68), Expect = 0.51 Identities = 17/71 (23%), Positives = 34/71 (47%) Frame = +1 Query: 259 RVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 438 +V+L LQ ++ + +Y+G++ I +E+GL S W+G + R L Sbjct: 36 KVRLQLQKSALAGDVTLP-KYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFGGLRIG 94 Query: 439 FKDKYKQVFLG 471 + K +++G Sbjct: 95 MYEPVKNLYVG 105 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +1 Query: 292 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 459 S+ + YKG +D FV+ K G ++F++G N R + F ++ K+ Sbjct: 240 SRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNFGRLGSWNVIMFLTLEQAKK 295 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 35.5 bits (78), Expect = 0.031 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 +YKG +DA +I +++G F+RG+ V+ Y P AL F Sbjct: 287 KYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWYLPASALTF 326 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 313 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 468 +RY G VDA+ I K +G+ + W G N+ R A A D+ K+ + Sbjct: 156 RRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIM 207 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 471 +Y+G + I +E+G+ W+G A + R L + K + +G Sbjct: 56 KYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVG 107 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 313 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 468 +RY G VDA+ I K +G+ + W G N+ R A A D+ K+ + Sbjct: 156 RRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIM 207 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 471 +Y+G + I +E+G+ W+G A + R L + K + +G Sbjct: 56 KYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVG 107 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 35.1 bits (77), Expect = 0.041 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 322 KGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 429 + I +F+ + ++QG W GN N+IR PTQA+ Sbjct: 83 RSIPGSFLEVVQKQGWQGLWAGNEINMIRIIPTQAI 118 >At4g24570.1 68417.m03521 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 34.7 bits (76), Expect = 0.054 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 301 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 468 +A + Y G+ DA + K +G+ S WRG+ + R A A D++K+ L Sbjct: 162 LAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMIVTAAQLASYDQFKEGIL 217 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 33.9 bits (74), Expect = 0.095 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 465 +YK I F + KEQG+ F+RG ++ Y A F F + +K+ + Sbjct: 112 KYKSISSGFGILLKEQGVKGFFRGWVPTLLGYSAQGACKFGFYEYFKKTY 161 >At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) identical to 36kDa-peroxisomal membrane protein (PMP36) GI:15146342 from [Arabidopsis thaliana] Length = 331 Score = 33.9 bits (74), Expect = 0.095 Identities = 18/63 (28%), Positives = 35/63 (55%) Frame = +1 Query: 262 VKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAF 441 VK LQ + V+ Q+YKG +DA +++ + +GL F++G +++ A+ F Sbjct: 255 VKSRLQAKQVTTGDKR-QQYKGTLDAILKMIRYEGLYGFYKGMSTKIVQSVLAAAVLFMI 313 Query: 442 KDK 450 K++ Sbjct: 314 KEE 316 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 33.9 bits (74), Expect = 0.095 Identities = 22/80 (27%), Positives = 34/80 (42%) Frame = +1 Query: 247 STHERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQA 426 S + VK+ +Q RY G ++AF +I + +G+ W+G N+ R F Sbjct: 133 SPADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNM 192 Query: 427 LNFAFKDKYKQVFLGGVDKK 486 A D K +DKK Sbjct: 193 GELACYDHAKHFV---IDKK 209 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/67 (29%), Positives = 35/67 (52%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 +R+K+LLQ+Q +I +A I K+ G+ F+RGN N+++ P A+ F Sbjct: 230 DRLKVLLQIQKTDARIR---------EAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKF 280 Query: 436 AFKDKYK 456 + +K Sbjct: 281 YAYELFK 287 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 203 FLAGGISAAVSKTAVAP 253 F+AGGI+ A S+TA AP Sbjct: 212 FIAGGIAGAASRTATAP 228 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 253 HERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 429 HE V+ LQ Q H S ++RY G+ D ++ ++ G F+RG N++R P + Sbjct: 234 HEVVRARLQEQGHHS-----EKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVI 288 Query: 430 NF 435 F Sbjct: 289 TF 290 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 33.5 bits (73), Expect = 0.13 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +1 Query: 271 LLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKD 447 ++++Q + D+R YK ++DA ++ + +G+ S WRG+ + R + A D Sbjct: 144 MVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQLASYD 203 Query: 448 KYKQVFL 468 K+ L Sbjct: 204 SVKETIL 210 >At2g34720.1 68415.m04264 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 198 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +3 Query: 339 LRPYPQGAGSPFILAW*LRQRHQVLPDPGAQLRLQGQVQAGVPRRC 476 L PYP P+ + +Q + P PG QL+L G Q GVP +C Sbjct: 52 LYPYPD----PYYRSVFAQQAYLPHPYPGVQLQLMGMQQPGVPLQC 93 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 32.3 bits (70), Expect = 0.29 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +1 Query: 322 KGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA-FKDKYKQVFLGGVDKKTQ 492 KG++D F R+ + +GL F RG F R P + F+ F+ + ++ + K+ Q Sbjct: 147 KGLLDGFPRVYRSEGLAGFHRGLFPLWCRNLPFSMVMFSTFEQSVEFIYQKIIQKRKQ 204 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 31.5 bits (68), Expect = 0.51 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +1 Query: 256 ERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 E VK +Q+Q + +RY +D V+ K G+ +RG A ++R A+ F Sbjct: 135 ELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLRECTGNAVFF 194 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 438 Y+GI D F + K++G WRG V R F FA Sbjct: 235 YEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFA 274 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 465 +YK I AF KEQGL F RG ++ Y A + + K+ + Sbjct: 101 KYKNITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLYEYAKKYY 150 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 301 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 459 +A + Y A RI ++G+L+ W+G V+R ALN Y Q Sbjct: 141 LAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVR---AMALNMGMLASYDQ 190 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 459 YKG+ D R+ +E+G+ +F+ V+ P A++FA + K+ Sbjct: 165 YKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVHFATYEAAKK 211 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/60 (23%), Positives = 29/60 (48%) Frame = +1 Query: 280 VQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 459 +Q V ++ AD + F+ K +GL F+RG N+++ P ++ + + K+ Sbjct: 415 LQVVRTRMQADSSKTTMKQEFMNTMKGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMKK 474 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 42 RNYSKSPVQKSGVSVS*SPIRVCRNS 119 R S+SPV+ S SVS SPIR+ R S Sbjct: 593 RRISRSPVRSSRKSVSRSPIRLSRRS 618 >At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 29.1 bits (62), Expect = 2.7 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 295 KQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 450 K+IA Y G + V P + S R NV +YFPT ++ +DK Sbjct: 119 KRIALFLDYDGTLSPIVEEPDCAYMSSAMRSAVQNVAKYFPTAIISGRSRDK 170 >At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 384 Score = 29.1 bits (62), Expect = 2.7 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 295 KQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 450 K+IA Y G + V P + S R NV +YFPT ++ +DK Sbjct: 118 KRIALFLDYDGTLSPIVEEPDCAYMSSAMRSAVQNVAKYFPTAIISGRSRDK 169 >At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 29.1 bits (62), Expect = 2.7 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 295 KQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 450 K+IA Y G + V P + S R NV +YFPT ++ +DK Sbjct: 119 KRIALFLDYDGTLSPIVEEPDCAYMSSAMRSAVQNVAKYFPTAIISGRSRDK 170 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 319 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 459 YKG+ D R+ +E+G +F+ V+ P A++F + K+ Sbjct: 167 YKGVWDCIKRVTREEGFGAFYASYRTTVLMNAPFTAVHFTTYEAVKR 213 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 325 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 474 GI AF I K G + +RG +A + P A+ F+F + K+ GG Sbjct: 78 GIRQAFRSIIKTDGPSALYRGIWAMGLGAGPAHAVYFSFYEVSKKFLSGG 127 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 462 +YKG+ D I +E+G + W+G V+ ++ F +K KQ+ Sbjct: 268 QYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQI 316 >At4g22590.1 68417.m03259 trehalose-6-phosphate phosphatase, putative similar to trehalose-6-phosphate phosphatase (AtTPPA) GI:2944178; contains Pfam profile PF02358: Trehalose-phosphatase Length = 377 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +1 Query: 274 LQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKY 453 + Q +K+IA Y G + V P + R +V +YFPT ++ +DK Sbjct: 99 IAAQAKNKKIAVFLDYDGTLSPIVDDPDRAIMSDAMRAAVKDVAKYFPTAIISGRSRDKV 158 Query: 454 KQV 462 Q+ Sbjct: 159 YQL 161 >At2g21040.1 68415.m02495 C2 domain-containing protein low similarity to phloem protein [Cucurbita maxima] GI:4164541; contains Pfam profile PF00168: C2 domain Length = 261 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 288 RQQADRRRPALQGYRRCLRPYPQGAGSPFILAW*LRQR 401 RQ+A R+ L G R P QGAGS + W L+ + Sbjct: 197 RQEAVRQGAGLSGSRFVKEPVRQGAGSSGVGVWPLKSQ 234 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +1 Query: 262 VKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 387 VK LQ+Q Q Q Y G++DAF I KE+G + ++G Sbjct: 130 VKTRLQLQTPLHQT---QPYSGLLDAFRTIVKEEGPRALYKG 168 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 435 RY G +DAF +I K +G+ ++G + R P A F Sbjct: 250 RYTGSMDAFRKILKSEGVKGLYKGFGPAMARSVPANAACF 289 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 358 EQGLLSFWRGNFANVIRYFPT--QALNFAFKDKYKQVFLGGVDKKTQFW 498 + G W I+ FP Q +F D ++F GGVD + W Sbjct: 159 DDGTAKLWDMRQRGAIQTFPDKYQITAVSFSDAADKIFTGGVDNDVKVW 207 >At5g26200.1 68418.m03118 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 316 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 438 RY+ DAF +I G F+RG +++ Y P+ A+ +A Sbjct: 181 RYRNGFDAFRKILYTDGPRGFYRGFGISILTYAPSNAVWWA 221 >At1g71680.1 68414.m08271 lysine and histidine specific transporter, putative similar to lysine and histidine specific transporter GB: AAC49885 GI:2576361 from (Arabidopsis thaliana); contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 434 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = -1 Query: 488 VFLSTPPRNTCLYLSLKAKLSAWVGKYLMTLAKLPRQNERRPCSLGIR 345 V +P N+ +SL A L +++ + ++A + + E RP + G+R Sbjct: 174 VLSQSPDFNSIKIVSLLAALMSFLYSMIASVASIAKGTEHRPSTYGVR 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,006,654 Number of Sequences: 28952 Number of extensions: 253430 Number of successful extensions: 907 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -