BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021874 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 42 5e-04 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 34 0.12 SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_24737| Best HMM Match : KID (HMM E-Value=0.096) 31 0.85 SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) 31 1.1 SB_12374| Best HMM Match : SlyX (HMM E-Value=1.2) 30 1.5 SB_46938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 30 1.5 SB_18068| Best HMM Match : Ribosomal_L22e (HMM E-Value=2.3) 30 1.5 SB_40386| Best HMM Match : BAR (HMM E-Value=0) 30 2.0 SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) 30 2.0 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 29 2.6 SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) 29 3.4 SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 29 3.4 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 29 3.4 SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 29 3.4 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 29 3.4 SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) 29 4.5 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 29 4.5 SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) 29 4.5 SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 28 6.0 SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) 28 6.0 SB_21688| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_11059| Best HMM Match : KID (HMM E-Value=0.046) 28 6.0 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) 28 6.0 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 28 7.9 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 28 7.9 SB_21209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_1179| Best HMM Match : IQ (HMM E-Value=1e-04) 28 7.9 SB_58439| Best HMM Match : L15 (HMM E-Value=1e-05) 28 7.9 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_18590| Best HMM Match : FYVE (HMM E-Value=8.8e-29) 28 7.9 SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/75 (30%), Positives = 40/75 (53%) Frame = +1 Query: 280 KIEEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTL 459 ++ A I EQ +E + KME +EKR++Y+ L++RL + VE+ R T+ Sbjct: 182 RVRVAQSIAQEQIEQQSKLIEEKIMQKMEMTKEKRDSYMEALKTRLHEKSLDVEQKRQTM 241 Query: 460 EQQTAEVYKAIEDKM 504 E+ K +E+K+ Sbjct: 242 EEIQMFQRKILEEKL 256 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 549 ERLREHEEQVRKVRAGNQEKFQQLESSIQEKLQQ 650 E+L+ HE +VR ++ QE+ +Q I+EK+ Q Sbjct: 174 EKLQAHERRVRVAQSIAQEQIEQQSKLIEEKIMQ 207 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/84 (22%), Positives = 47/84 (55%) Frame = +1 Query: 262 IAQKMAKIEEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVE 441 +A + K ++ R ++ Q + + ++ + + + H EK EA NE++ + K+ L+ + Sbjct: 432 MATEQEKESKSLRKKNNQLEDELTNQGKSKEQEAQEHSEKYEALKNEMQQQGKEWLKQDK 491 Query: 442 KTRLTLEQQTAEVYKAIEDKMTKL 513 ++ +E++ E K++ D++ KL Sbjct: 492 ESHKQIEEREKEC-KSLRDEVRKL 514 Score = 31.9 bits (69), Expect = 0.49 Identities = 19/73 (26%), Positives = 40/73 (54%) Frame = +1 Query: 286 EEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQ 465 +E R+++E +N KE +M T +EK + + ++L+D L K++ Q Sbjct: 413 KEMHRLKNEWSN------KEKEYKRMATEQEKESKSLRKKNNQLEDELTNQGKSKEQEAQ 466 Query: 466 QTAEVYKAIEDKM 504 + +E Y+A++++M Sbjct: 467 EHSEKYEALKNEM 479 >SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 33.5 bits (73), Expect = 0.16 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +1 Query: 283 IEEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEG-VEKTRLTL 459 ++E R+ E + A ++AL+A +E R+ + ELR ++ + E +E+ R+ Sbjct: 38 LDELRRVMQEDKDQ---AIRDALNAAEAKAQEDRKQALEELRKKMNEEREQCLEQARIRA 94 Query: 460 EQQTAEV 480 E+Q AE+ Sbjct: 95 EEQMAEI 101 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +3 Query: 531 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESSIQEK 641 +L+ M+E+ R+ E++ K+ +++K QQLE+ +Q K Sbjct: 1231 DLQSMVEQDRQRAERMEKLALEHEKKVQQLETELQSK 1267 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/42 (35%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 528 ENLKKMIER-LREHEEQVRKVRAGNQEKFQQLESSIQEKLQQ 650 E K++I + L EE++ +VR Q+K +QLE+ ++E+ Q+ Sbjct: 2276 ERDKQLISKELEAKEEELEEVRYSMQKKIKQLEAQLEEEYQE 2317 >SB_24737| Best HMM Match : KID (HMM E-Value=0.096) Length = 636 Score = 31.1 bits (67), Expect = 0.85 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Frame = +1 Query: 262 IAQKMAKIEEASR--IRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEG 435 IA K A++ E +SEQ + + ++++ E RE I++L LKD Sbjct: 108 IASKEAELRELGEKLTKSEQEKSDELGKVWETMTELQSVIEDREKSIDKLEKELKDQEAK 167 Query: 436 VEKTRLTLEQQTAEVYKAIEDK 501 + + TLEQ A++ + +E K Sbjct: 168 HNRQKNTLEQTVAKMKEVMERK 189 >SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) Length = 301 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 Query: 527 REPQEDDRASART*GTSSQGPRR*PGEVPAARELHPGEAAAGRR 658 +EP + R ART + P R P A HPG AGRR Sbjct: 22 QEPGKPAREPARTPVAALPAPARVTSPEPPATRPHPGRVEAGRR 65 >SB_12374| Best HMM Match : SlyX (HMM E-Value=1.2) Length = 157 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +2 Query: 38 KVEAMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKA 217 ++E + KSTE+R QE YE +E + +T +E ++EK + Sbjct: 46 ELEPLAEMLKSTELRLQEAQDRLFTYERRASEHTKLIAELTQKVESQTDQLEHMREKYRL 105 Query: 218 AEERRRSLE 244 ++ RSL+ Sbjct: 106 TQDEYRSLQ 114 >SB_46938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +2 Query: 38 KVEAMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKA 217 ++E + KSTE+R QE YE +E + +T +E ++EK + Sbjct: 67 ELEPLAEMLKSTELRLQEAQDRLFTYERRASEHTKLIAELTQKVESQTDQLEHMREKYRL 126 Query: 218 AEERRRSLE 244 ++ RSL+ Sbjct: 127 TQDEYRSLQ 135 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 280 KIEEASRIRSEQT-NNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLT 456 ++EEA+R E+ N + + AL KM EE ELR RL+D E+ R Sbjct: 449 ELEEAARREEEERIRNMEESERLALQEKMRREEE-------ELRRRLEDQRRREEEERRV 501 Query: 457 LEQQ 468 LE+Q Sbjct: 502 LEEQ 505 >SB_18068| Best HMM Match : Ribosomal_L22e (HMM E-Value=2.3) Length = 258 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/77 (25%), Positives = 36/77 (46%) Frame = +1 Query: 283 IEEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLE 462 +EE R+ Q + +T A E+ E E +R +D L G+++ L Sbjct: 149 LEEEKRMLKLQALITVCSTNIGKYALGYLQLEQNELEHQEELNRARDQLTGMQRGNLQEN 208 Query: 463 QQTAEVYKAIEDKMTKL 513 + ++ + ++DKMTKL Sbjct: 209 VELIKLQRDVKDKMTKL 225 >SB_40386| Best HMM Match : BAR (HMM E-Value=0) Length = 369 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +2 Query: 8 VQLVRSLCRLKVEAMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRA--DSPEKT 181 + ++ LC+L V+ +E KSTE E++ L ++ A A +PE+ Sbjct: 207 MDMIEQLCQLVVDMLEYHKKSTE--SLEIAMSQLNKRIVNARRNQAEAEASAPKQAPEEP 264 Query: 182 PSVEEIQEKLKAAEERRRSLEAS 250 +V E EK ++E + + E S Sbjct: 265 ENVPEQHEKAPESDEEQGNGETS 287 >SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1805 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/58 (24%), Positives = 34/58 (58%) Frame = +1 Query: 340 KEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTKL 513 +E ++ T E EA +++L + EG+ +++++L++ +E++ +EDK +L Sbjct: 447 QEDIERHQLTKERLHEA-VSDLLELTRGETEGLRESQISLDENWSELWALLEDKEEEL 503 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 53 EVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKT--PSVEEIQEKLKAAEE 226 E E TE + ++ G + + LA +GV P ADS E+ P +EK E Sbjct: 285 EEENSETEEQPRKPVGGPINFAAELASKIGVAPPPAADSDEEAAEPGAWSDEEKKPQQPE 344 Query: 227 RRRS 238 ++RS Sbjct: 345 KQRS 348 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 29.5 bits (63), Expect = 2.6 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 3/89 (3%) Frame = +1 Query: 256 AAIAQKMAKIEEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYI---NELRSRLKDH 426 A +++KMA+ EE +R+R + + ++ A +AK + E + N+ S LK Sbjct: 1263 ANLSRKMAETEEDNRVREKDLTTALDESRRA-EAKAVDKVKNLENILDNANQDNSDLKLK 1321 Query: 427 LEGVEKTRLTLEQQTAEVYKAIEDKMTKL 513 + G E LE Q A + A D KL Sbjct: 1322 MSGAEGRITGLEAQLARMEGAKNDLEFKL 1350 >SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 53 EVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKT--PSVEEIQEKLKAAEE 226 E E TE + ++ G + + LA +GV P ADS E+ P +EK E Sbjct: 149 EEENSETEEQPRKPVGGPINFAAELASKIGVAPPPAADSDEEAAEPGAWSDEEKKPQQPE 208 Query: 227 RRRS 238 ++RS Sbjct: 209 KQRS 212 >SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) Length = 440 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/54 (24%), Positives = 29/54 (53%) Frame = +1 Query: 346 ALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMT 507 AL K + + +N+ +L + +EG++ T +TL+QQ ++ + + + T Sbjct: 235 ALQKKYSDELKSSQDELNDFVIQLDEEVEGMQSTIMTLQQQIKDIKQRLATETT 288 >SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1214 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 286 EEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDH 426 EE + +E +NF+VA + A M++ E + + + RSR +H Sbjct: 1125 EETTSSTAETGSNFLVAVLNNMQASMQSSNELLKELVIQKRSRSPNH 1171 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 400 ELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTKL 513 E+R L D +EGVE + LE Q + IE+ K+ Sbjct: 226 EMRKVLHDSMEGVEAEKRELENQAQNCKQEIEEATNKI 263 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 400 ELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTKL 513 E+R L D +EGVE + LE Q + IE+ K+ Sbjct: 226 EMRKVLHDSMEGVEAEKRELENQAQNCKQEIEEATNKI 263 >SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 1353 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 5/66 (7%) Frame = +2 Query: 464 SRPRKCTRP-----SKIR*PSCRQA*REPQEDDRASART*GTSSQGPRR*PGEVPAAREL 628 SR K ++P S+ R SC+ +PQ+ D+ S R S + + P + AAR+ Sbjct: 877 SRKTKTSKPQHKQASRPRHASCKTMASKPQDQDKQSTRPGQKSRKTRTKKPQDKQAARQS 936 Query: 629 HPGEAA 646 P +A+ Sbjct: 937 RPRQAS 942 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = +1 Query: 271 KMAKIEEA-SRIRSEQTNNFIVATK-EALDAKMETHEEKREAYINELRSRLKDHLEGVEK 444 K A E+ SR+ SE + I K + +A +E ++K + INE R +L++ ++ Sbjct: 1446 KAASAEKTRSRLNSELEDALIDLEKAQTNNANLEKKQKKIDIQINEWRVKLEEVQADLDN 1505 Query: 445 TRLTLEQQTAEVYK 486 ++ + E+YK Sbjct: 1506 SQKEARNYSTEMYK 1519 >SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 543 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 534 LKKMIERLREHEEQVRKVRAGNQEKFQQLESSI 632 LKK+++ E E + K NQ+K ++L++SI Sbjct: 68 LKKVVKTAEEKREALEKELKKNQQKLEELQASI 100 >SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) Length = 482 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 527 REPQEDDRASART*GTSSQGPRR*PGEVPAARELHPGEAAAGRR 658 +EP + + ART + GP R P A HPG AGRR Sbjct: 93 QEPGKRHQEPART--PVAAGPARITSPEPPATRPHPGRVEAGRR 134 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 340 KEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTA 474 K+ D+ E H+E ++ + E K H+E ++ T + +EQQ A Sbjct: 1422 KKVQDSSNEIHKENQD--LREELKMAKRHIESLKSTLIQVEQQAA 1464 >SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) Length = 437 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/60 (35%), Positives = 25/60 (41%) Frame = +2 Query: 479 CTRPSKIR*PSCRQA*REPQEDDRASART*GTSSQGPRR*PGEVPAARELHPGEAAAGRR 658 C +P+ S A QE ART S+ R E PA R HPG+ GRR Sbjct: 9 CAQPAGTANGSAEPADEHHQEAAHEPART--PSALVERITSPEPPATRPKHPGQVETGRR 66 >SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Frame = +1 Query: 262 IAQKMAKIEEASR--IRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEG 435 IA K A++ E +SEQ + + ++++ E R I++L LKD Sbjct: 552 IASKEAELRELGEKLTKSEQEKSDELGKVWETMTELQSVIEDRGKSIDKLEKELKDQEAK 611 Query: 436 VEKTRLTLEQQTAEVYKAIEDK 501 + + TLEQ A++ + +E K Sbjct: 612 HNRQKNTLEQTVAKMKEVMERK 633 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/52 (32%), Positives = 32/52 (61%) Frame = +1 Query: 358 KMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTKL 513 +ME+ +EK E+ + ELR++L D LE + T +E++ E+ E ++ +L Sbjct: 118 EMESEQEKHESELEELRAQL-DKLENSD-TESLVEERMKELKANYEREVEEL 167 >SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) Length = 770 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 605 EVPAARELHPGEAAAGRR 658 E PAAR HPG AGRR Sbjct: 225 EPPAARPKHPGRVEAGRR 242 >SB_21688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1078 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 531 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESSIQEKLQQAADRR 665 N++KM+E R+ + K+R N F Q ++ Q L ++ R Sbjct: 225 NVQKMLENSRQENSRTLKIRGQNSAFFSQQLTAFQVWLAMGSEMR 269 >SB_11059| Best HMM Match : KID (HMM E-Value=0.046) Length = 296 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Frame = +1 Query: 262 IAQKMAKIEEASR--IRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEG 435 IA K A++ E +SEQ + + ++++ E R I++L LKD Sbjct: 16 IASKEAELRELGEKLTKSEQEKSDELGKVWETMTELQSVIEDRGKSIDKLEKELKDQEAK 75 Query: 436 VEKTRLTLEQQTAEVYKAIEDK 501 + + TLEQ A++ + +E K Sbjct: 76 HNRQKNTLEQTVAKMKEVMERK 97 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/42 (35%), Positives = 27/42 (64%) Frame = +3 Query: 531 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESSIQEKLQQAA 656 +L+ + R++E EE+ K+R + E+ +LE S+ K Q+AA Sbjct: 301 SLEAALRRVKELEEENAKIRKQSAEEKDELEKSV--KRQEAA 340 >SB_56374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 483 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 158 RADSPEKTPSVEEIQEKLKAAEERRRSLEASK 253 +A KT + +QEKL+A RRR +E K Sbjct: 438 KAQELNKTRVEQGLQEKLRARRSRRRKMEVEK 469 >SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) Length = 3616 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -3 Query: 99 FDISWQRISVDLVSTSMASTFNRQRLRTS 13 +DI WQ ++++ ++ + NR+RL TS Sbjct: 1447 YDILWQDVNIEKINQELLDFQNRRRLTTS 1475 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 527 REPQEDDRASART*GTSSQGPRR*PGEVPAARELHPGEAAAGRR 658 +EP + R ART + R P A HPG AGRR Sbjct: 797 QEPGKQRREPARTPVAALPAAARVTSPEPPATRPHPGRVEAGRR 840 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/78 (24%), Positives = 37/78 (47%) Frame = +1 Query: 274 MAKIEEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRL 453 M +++A+ R+++ N ++ T+ D + E Y LR + +DH V + Sbjct: 412 MRDLDKANE-RNKELNESVIQTQSEKDTIKHSLHMMEEQY-KGLRQQQEDHRSTVNELET 469 Query: 454 TLEQQTAEVYKAIEDKMT 507 LE + ++ A E+K T Sbjct: 470 KLEVLSKKLLVANEEKST 487 >SB_21209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 176 KTPSVEEIQEKLKAAEERRR 235 K P + E+QEKLKA +E RR Sbjct: 281 KDPKLLELQEKLKAKKEERR 300 >SB_1179| Best HMM Match : IQ (HMM E-Value=1e-04) Length = 474 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/82 (18%), Positives = 39/82 (47%) Frame = +1 Query: 259 AIAQKMAKIEEASRIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGV 438 ++ +++ ++++ +Q N I K+ L +M+ YI + RLK ++ Sbjct: 225 SLQRQLVEVKKEKESEIQQRNEMIAHLKDQLQ-EMKAKTSMEGKYIKKDAERLKFKIDEE 283 Query: 439 EKTRLTLEQQTAEVYKAIEDKM 504 E+ +E + ++ +E+K+ Sbjct: 284 ERVNNEIEAYLKQHHQILEEKV 305 >SB_58439| Best HMM Match : L15 (HMM E-Value=1e-05) Length = 203 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Frame = +2 Query: 56 VETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEK-TPSVEEIQEK--LKAAEE 226 +E + +I C +K GL + + G P+PRRA P K P ++ + L AE+ Sbjct: 127 IERQGGKITCAHYNKLGLRVLLKPEKFEGKPIPRRAHPPSKLLPYYSSVEHRGYLADAEQ 186 Query: 227 -RRRSLEASK 253 + LE+ K Sbjct: 187 VEKARLESRK 196 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 587 PRR*PGEVPAARELHPGEAAAGRR 658 P R P E PA R HPG AGRR Sbjct: 1064 PARTP-EPPATRPKHPGRVEAGRR 1086 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +3 Query: 528 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESSIQEKLQQAADRRL 668 E ++ ++R +E +EQ RK +E+ ++ + K ++ AD+ L Sbjct: 993 EKRERELQRKKERDEQKRKKEEEKREREEKKRKEEERKRREKADKEL 1039 >SB_18590| Best HMM Match : FYVE (HMM E-Value=8.8e-29) Length = 551 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 2/61 (3%) Frame = +1 Query: 337 TKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTA--EVYKAIEDKMTK 510 +K K+E+ +E ++ INEL + + EG+++ E++ + E+ K +E+K K Sbjct: 26 SKNLYAKKLESEKELQD-KINELNTEISSLQEGMQELGTIAEKEISLDEMQKCLEEKEDK 84 Query: 511 L 513 L Sbjct: 85 L 85 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +1 Query: 313 QTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEK--TRLTLEQQTAEVYK 486 QT I+ E ME + + E EL +L+ K T+L L Q+TAE YK Sbjct: 401 QTQILILQVHEDYRKLMEQKQAEEERCRKELEEKLQTLERDSHKYRTKLELAQKTAETYK 460 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,490,051 Number of Sequences: 59808 Number of extensions: 297408 Number of successful extensions: 1585 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 1397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1584 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -