BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021874 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 24 1.5 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 3.5 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 23 3.5 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 3.5 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 4.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.7 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.8 bits (49), Expect = 1.5 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 9/52 (17%) Frame = +1 Query: 373 EEKREAYINELRSRLKDHLEGV---------EKTRLTLEQQTAEVYKAIEDK 501 E+K + + + S+L D LE V E +LTL Q+TA+ +K ++DK Sbjct: 354 EKKNLSKVIDQHSQLIDTLENVLAIVDRLMDETNQLTL-QETADAFKDLQDK 404 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 402 LVDVGLAFFLVGLHLGVESLLGGDDEVI 319 L+D + F + LG+ L +DEV+ Sbjct: 146 LMDSDVIFVTINYRLGILGFLSTEDEVV 173 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 402 LVDVGLAFFLVGLHLGVESLLGGDDEVI 319 L+D + F + LG+ L +DEV+ Sbjct: 17 LMDSDVIFVTINYRLGILGFLSTEDEVV 44 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 402 LVDVGLAFFLVGLHLGVESLLGGDDEVI 319 L+D + F + LG+ L +DEV+ Sbjct: 146 LMDSDVIFVTINYRLGILGFLSTEDEVV 173 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 166 LTRKDSFRRRDPREAEGSRRE 228 L +SFR+R REA G+ R+ Sbjct: 433 LAGDESFRKRRQREAAGNCRK 453 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 552 RLREHEEQVRKVRAGNQEKFQQLESSIQEKLQQ 650 R+R +EQ R Q++ QQ + Q++ QQ Sbjct: 1194 RIRGLQEQQRNAAMVQQQQQQQQQQQQQQQQQQ 1226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,205 Number of Sequences: 438 Number of extensions: 2506 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -