BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021873X (402 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.08c |arg4||carbamoyl-phosphate synthase Arg4|Schizosacch... 29 0.36 SPCC1827.02c |||cholinephosphate cytidylyltransferase |Schizosac... 28 0.62 SPAC926.06c |||leucine-rich repeat protein, unknown|Schizosaccha... 25 3.3 >SPBC215.08c |arg4||carbamoyl-phosphate synthase Arg4|Schizosaccharomyces pombe|chr 2|||Manual Length = 1160 Score = 28.7 bits (61), Expect = 0.36 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +3 Query: 162 RRQRVTRHHWFKKTAPFEAEFKSFTTNYKMFVYN 263 RR+R+ H W KK AEF + TNY YN Sbjct: 586 RRKRLDVHPWVKKIDTLAAEFPAH-TNYLYTSYN 618 >SPCC1827.02c |||cholinephosphate cytidylyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 354 Score = 27.9 bits (59), Expect = 0.62 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = +3 Query: 147 RHRLPRRQRVTRHHWFKKTAPFEAEFKSF----TTNYKM 251 RH + + R+HW T +A+ KSF TT+Y++ Sbjct: 260 RHHIKVLRDTLRNHWVSTTRDLKADIKSFLSMATTDYQL 298 >SPAC926.06c |||leucine-rich repeat protein, unknown|Schizosaccharomyces pombe|chr 1|||Manual Length = 621 Score = 25.4 bits (53), Expect = 3.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 81 GERPLRSLAERARRHARDVTRARHRLP 161 GE+ +R+LA R H + RA +R P Sbjct: 7 GEKYIRNLASYIRSHEKRFARAPYRAP 33 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,225,027 Number of Sequences: 5004 Number of extensions: 20921 Number of successful extensions: 50 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -