BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021873X (402 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X76302-1|CAA53949.1| 163|Homo sapiens nucleic acid binding prot... 29 4.4 U31762-1|AAC51171.1| 285|Homo sapiens homeobox protein protein. 29 4.4 BC017890-1|AAH17890.1| 155|Homo sapiens putative nucleic acid b... 29 4.4 AC019206-3|AAY14866.1| 155|Homo sapiens unknown protein. 29 4.4 AF068227-1|AAC27614.1| 407|Homo sapiens putative transmembrane ... 29 5.8 U37146-1|AAC50236.1| 1495|Homo sapiens silencing mediator of ret... 29 7.7 S83390-1|AAB50847.1| 769|Homo sapiens T3 receptor-associating c... 29 7.7 BC004326-1|AAH04326.1| 606|Homo sapiens Unknown (protein for IM... 29 7.7 AY965853-1|AAX77219.1| 2461|Homo sapiens SMRTE-tau protein. 29 7.7 AF125672-1|AAD22973.1| 2507|Homo sapiens silencing mediator of r... 29 7.7 AF113003-1|AAD20946.1| 2517|Homo sapiens silencing mediator of r... 29 7.7 >X76302-1|CAA53949.1| 163|Homo sapiens nucleic acid binding protein protein. Length = 163 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPRRQRVTRHHWFKKTAPFEAEFK 227 S++ ER R ER+R RD R+R R P R+R + T+P + K Sbjct: 26 STSRERERRR-RERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLK 76 >U31762-1|AAC51171.1| 285|Homo sapiens homeobox protein protein. Length = 285 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 70 LAAPASGRSVPW--PSALGATRVTSHARVTASHGANV*RVITG 192 L P +G +VPW PSA RVT RV A GA + V G Sbjct: 148 LRPPTAGAAVPWLWPSARFLPRVTGPIRVGAPLGAELRLVSPG 190 >BC017890-1|AAH17890.1| 155|Homo sapiens putative nucleic acid binding protein RY-1 protein. Length = 155 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPRRQRVTRHHWFKKTAPFEAEFK 227 S++ ER R ER+R RD R+R R P R+R + T+P + K Sbjct: 18 STSRERERRR-RERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLK 68 >AC019206-3|AAY14866.1| 155|Homo sapiens unknown protein. Length = 155 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPRRQRVTRHHWFKKTAPFEAEFK 227 S++ ER R ER+R RD R+R R P R+R + T+P + K Sbjct: 18 STSRERERRR-RERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLK 68 >AF068227-1|AAC27614.1| 407|Homo sapiens putative transmembrane protein protein. Length = 407 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +3 Query: 192 FKKTAPFEAEFKSFTTNY-KMFVYN 263 F K A F AEFK+ TNY ++F+Y+ Sbjct: 288 FNKLAEFGAEFKNIETNYTRIFLYS 312 >U37146-1|AAC50236.1| 1495|Homo sapiens silencing mediator of retinoid and thyroid hormone action protein. Length = 1495 Score = 28.7 bits (61), Expect = 7.7 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPR-RQRVTRHHWFKKTAPFEAEFKSF 233 S PL A + H R VT A+H Q TRHH + +AP A SF Sbjct: 1090 SQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSF 1144 >S83390-1|AAB50847.1| 769|Homo sapiens T3 receptor-associating cofactor-1 protein. Length = 769 Score = 28.7 bits (61), Expect = 7.7 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPR-RQRVTRHHWFKKTAPFEAEFKSF 233 S PL A + H R VT A+H Q TRHH + +AP A SF Sbjct: 410 SQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSF 464 >BC004326-1|AAH04326.1| 606|Homo sapiens Unknown (protein for IMAGE:3629785) protein. Length = 606 Score = 28.7 bits (61), Expect = 7.7 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPR-RQRVTRHHWFKKTAPFEAEFKSF 233 S PL A + H R VT A+H Q TRHH + +AP A SF Sbjct: 201 SQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSF 255 >AY965853-1|AAX77219.1| 2461|Homo sapiens SMRTE-tau protein. Length = 2461 Score = 28.7 bits (61), Expect = 7.7 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPR-RQRVTRHHWFKKTAPFEAEFKSF 233 S PL A + H R VT A+H Q TRHH + +AP A SF Sbjct: 2102 SQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSF 2156 >AF125672-1|AAD22973.1| 2507|Homo sapiens silencing mediator of retinoic acid and thyroid hormone receptor extended isofo protein. Length = 2507 Score = 28.7 bits (61), Expect = 7.7 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPR-RQRVTRHHWFKKTAPFEAEFKSF 233 S PL A + H R VT A+H Q TRHH + +AP A SF Sbjct: 2102 SQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSF 2156 >AF113003-1|AAD20946.1| 2517|Homo sapiens silencing mediator of retinoic acid and thyroid hormone receptor alpha protein. Length = 2517 Score = 28.7 bits (61), Expect = 7.7 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 72 SSAGERPLRSLAERARRHARDVTRARHRLPR-RQRVTRHHWFKKTAPFEAEFKSF 233 S PL A + H R VT A+H Q TRHH + +AP A SF Sbjct: 2112 SQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSF 2166 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,776,656 Number of Sequences: 237096 Number of extensions: 661398 Number of successful extensions: 1525 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1525 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2928276690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -