BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021869 (630 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 2.6 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.6 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 6.1 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 6.1 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 6.1 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.0 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.0 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 8.0 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 24.6 bits (51), Expect = 2.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 139 VPGLHFRAPLSQCRAKTIKQIAIKHLISL 53 V +HFR+P + A ++ I I HL L Sbjct: 323 VLNIHFRSPQTHTMAPWVRTIFINHLPKL 351 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 404 CLDNGLGLCSLDACRRSSTPKKFELIQGREC 496 C G +C + C R P ELI GR C Sbjct: 560 CSGRGQCVCGVCVCERRPNPD--ELIDGRYC 588 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 6.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 395 CYNPSGRRCLADNAQVQ 345 CY+PS R+C + Q + Sbjct: 1447 CYSPSDRQCAEEREQAE 1463 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.4 bits (48), Expect = 6.1 Identities = 11/44 (25%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 419 LGLCSLDA-CRRSSTPKKFELIQGRECAPGSRGRTSVTVVGAMP 547 +G+C+ C P + GR+ RG+ V+ +MP Sbjct: 126 IGMCAFGIECNSMRNPDAEFRVMGRKIFSKPRGKVKSLVINSMP 169 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 6.1 Identities = 12/36 (33%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 260 ESNCHFCRCSDSGV--AECLRQDSCDQIIFTEPVRC 361 E CH C C SG ++C + C E RC Sbjct: 981 EDGCHACDCDPSGSKGSQCNQYGQCPCNDNVEGRRC 1016 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.0 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -2 Query: 446 YRHPRSIGPDRYLSRRKCYNPS 381 Y HP + PD +L R P+ Sbjct: 151 YPHPETFNPDNFLPERTQNRPT 172 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.0 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -2 Query: 446 YRHPRSIGPDRYLSRRKCYNPS 381 Y HP + PD +L R P+ Sbjct: 151 YPHPETFNPDNFLPERTQNRPT 172 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 141 EGPCAAEQESKDKPSQITTDDA 206 EG AAE+ +KD + DDA Sbjct: 366 EGEAAAEEAAKDDEDEDDEDDA 387 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,135 Number of Sequences: 2352 Number of extensions: 17514 Number of successful extensions: 100 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -