BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021867X (547 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 29 2.0 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 28 3.5 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 493 GQRELQTATISIPNTNISDSPLRMRNVDVRFA*AYRQA 380 G+R ++ +SIP TN+ + R ++D +FA +QA Sbjct: 820 GERRIRVLNLSIPCTNMLSNLFRSADLDSQFACMLKQA 857 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 28.3 bits (60), Expect = 3.5 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = -1 Query: 496 HGQRELQTATISIPNTNISDSPLRMRNVDVRFA*AYRQA 380 +G+R ++ T+S+ TN+ + R ++D +FA +QA Sbjct: 804 YGERRIRVTTLSLSCTNMLSNLFRAADLDSQFACMLKQA 842 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,531,018 Number of Sequences: 28952 Number of extensions: 188123 Number of successful extensions: 338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -