BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021863 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.4 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 4.4 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 4.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.4 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 51 ELPAAPFDLQVLDEVGLDSGNISGCP--TNSDYVRYVM 158 E+P P+ L+VLD+ G P NS RYV+ Sbjct: 874 EVPEVPYGLKVLDKSGRSVQLSWAAPYDGNSPIKRYVI 911 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 234 ELCIAQLRPPPNGTERWCWNRSWGPAA 314 +L +A L PP N ++W + +W P A Sbjct: 88 QLVLAALYPP-NKLQQWNEDLNWQPIA 113 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 234 ELCIAQLRPPPNGTERWCWNRSWGPAA 314 +L +A L PP N ++W + +W P A Sbjct: 103 QLVLAALYPP-NKLQQWNEDLNWQPIA 128 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,831 Number of Sequences: 438 Number of extensions: 3919 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -