BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021859 (787 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 104 8e-23 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 99 4e-21 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 73 2e-13 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 48 7e-06 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 47 1e-05 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 43 2e-04 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 43 2e-04 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 42 5e-04 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 41 8e-04 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 41 8e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 41 0.001 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 41 0.001 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 41 0.001 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 38 0.006 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 38 0.006 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 38 0.008 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 38 0.010 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 38 0.010 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 37 0.017 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 37 0.017 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 36 0.023 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 36 0.030 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 35 0.053 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 35 0.053 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 35 0.070 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 35 0.070 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 34 0.093 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 34 0.093 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 33 0.16 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 33 0.21 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 33 0.21 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 33 0.21 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 33 0.28 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 33 0.28 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 31 0.66 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 31 0.66 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 31 0.66 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 31 1.1 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 31 1.1 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 30 2.0 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 30 2.0 At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containi... 29 2.6 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 29 2.6 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 29 2.6 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 29 2.6 At1g74960.2 68414.m08700 3-ketoacyl-ACP synthase, putative simil... 29 3.5 At1g74960.1 68414.m08699 3-ketoacyl-ACP synthase, putative simil... 29 3.5 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 29 4.6 At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containi... 29 4.6 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 28 6.1 At5g46290.1 68418.m05698 3-oxoacyl-[acyl-carrier-protein] syntha... 28 6.1 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 28 6.1 At5g23940.1 68418.m02811 transferase family protein similar to a... 28 8.1 At4g15010.3 68417.m02307 mitochondrial substrate carrier family ... 28 8.1 At4g15010.2 68417.m02306 mitochondrial substrate carrier family ... 28 8.1 At4g15010.1 68417.m02305 mitochondrial substrate carrier family ... 28 8.1 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 104 bits (249), Expect = 8e-23 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 2/174 (1%) Frame = +1 Query: 262 VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 V PLDLVKC +Q+D KYK++ +GF + ++E+GV+G +GW PT +GYS QG CKFGFYE Sbjct: 96 VTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGFFRGWVPTLLGYSAQGACKFGFYE 155 Query: 442 VFKVAYAGMLDDETAYTYRTFVSWRRLRRRNSSPTSPCRPWR--RLRSVSKPCLVSRAPS 615 FK Y+ + E Y+T + P+ ++R ++P +R S Sbjct: 156 YFKKTYSDLAGPEYTAKYKTLIYLAGSASAEIIADIALCPFEAVKVRVQTQPGF-ARGMS 214 Query: 616 ARRGRRWSRTKLRHVLQGPGAALGQTDPVHDDEVCLLRTHLELLYQYVVPSPVS 777 + + +G G+ P + T +E++Y+Y +P+P S Sbjct: 215 DGFPKFIKSEGYGGLYKGLAPLWGRQIPYTMMKFASFETIVEMIYKYAIPNPKS 268 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 510 LAASASAEFIADIALSPMEAAKVRIQTMPGFASTLREAWPKMVKNE 647 LA SASAE IADIAL P EA KVR+QT PGFA + + +PK +K+E Sbjct: 179 LAGSASAEIIADIALCPFEAVKVRVQTQPGFARGMSDGFPKFIKSE 224 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 638 QERSYGTFYKGLVPLWGRQIPYTMMKFACFE 730 + YG YKGL PLWGRQIPYTMMKFA FE Sbjct: 222 KSEGYGGLYKGLAPLWGRQIPYTMMKFASFE 252 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 98.7 bits (235), Expect = 4e-21 Identities = 37/84 (44%), Positives = 59/84 (70%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 435 TA+ PLD++KC +Q+D KYKN+ + FK +++E+G++G +GW+PT +GYS QG K+G Sbjct: 83 TAITPLDVIKCNMQIDPLKYKNITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGL 142 Query: 436 YEVFKVAYAGMLDDETAYTYRTFV 507 YE K Y+ ++ E A Y+T + Sbjct: 143 YEYAKKYYSDIVGPEYAAKYKTLI 166 Score = 64.5 bits (150), Expect = 8e-11 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +3 Query: 510 LAASASAEFIADIALSPMEAAKVRIQTMPGFASTLREAWPKMVKNE 647 LA SASAE +AD+AL PMEA KVR+QT PGFA L + PK++K+E Sbjct: 168 LAGSASAEIVADVALCPMEAVKVRVQTQPGFARGLSDGLPKIIKSE 213 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 662 YKGLVPLWGRQIPYTMMKFACFERTLSCCTSMLCQAP 772 +KGLVPLWGRQIPYTMMKFA FE T+ + P Sbjct: 219 HKGLVPLWGRQIPYTMMKFATFENTVELIYKKVMPTP 255 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 72.9 bits (171), Expect = 2e-13 Identities = 30/71 (42%), Positives = 46/71 (64%) Frame = +1 Query: 259 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 438 A+ PLD++K +QV+ KY ++ +GF +RE G L +GW+ +GY +QG C+FG Y Sbjct: 35 AITPLDVLKVNMQVNPVKYNSIPSGFSTLLREHGHSYLWRGWSGKLLGYGVQGGCRFGLY 94 Query: 439 EVFKVAYAGML 471 E FK Y+ +L Sbjct: 95 EYFKTLYSDVL 105 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 4/60 (6%) Frame = +3 Query: 516 ASASAEFIADIALSPMEAAKVRIQTMPGFASTLREAWPKMVKNEVTARSTRA----WCRS 683 +SASA+ AD+AL P EA KVR+QT P FA L + +P++ ++E A R WCR+ Sbjct: 117 SSASAQIFADMALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFPLWCRN 176 Score = 36.7 bits (81), Expect = 0.017 Identities = 12/27 (44%), Positives = 22/27 (81%) Frame = +2 Query: 659 FYKGLVPLWGRQIPYTMMKFACFERTL 739 F++GL PLW R +P++M+ F+ FE+++ Sbjct: 165 FHRGLFPLWCRNLPFSMVMFSTFEQSV 191 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 259 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 390 A+ P + +K R+Q K +++GF R EG+ G +G P Sbjct: 128 ALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFP 171 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 48.0 bits (109), Expect = 7e-06 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 429 +A PLDLV+ RL Y+ V + F+ REEG+ GL KG T +G F Sbjct: 192 SATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAISF 251 Query: 430 GFYEVFK 450 YE FK Sbjct: 252 AAYETFK 258 Score = 32.3 bits (70), Expect = 0.38 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 396 TA PLDLV+ R+Q++ A Y + G FK + EG+RGL +G P + Sbjct: 287 TATFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEY 339 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/101 (28%), Positives = 43/101 (42%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 447 PL+LVK RL + YK + + F +REEG L +G AP+ IG + Y+ Sbjct: 224 PLELVKTRLTIQRGVYKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAATNYFAYDSL 283 Query: 448 KVAYAGMLDDETAYTYRTFVSWRRLRRRNSSPTSPCRPWRR 570 + AY E T + +S+ T P R+ Sbjct: 284 RKAYRSFSKQEKIGNIETLLIGSLAGALSSTATFPLEVARK 324 Score = 31.5 bits (68), Expect = 0.66 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEK----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 423 TA PL++ + +QV A YKN+++ + EG+ G KG P+ + Sbjct: 314 TATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGI 373 Query: 424 KFGFYEVFK 450 F YE K Sbjct: 374 SFMCYEACK 382 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAE----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 423 +A P+D+V+ RL V +Y+ + + +REEG R L +GW P+ IG Sbjct: 157 SATYPMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGL 216 Query: 424 KFGFYEVFK 450 F YE K Sbjct: 217 NFSVYESLK 225 Score = 37.1 bits (82), Expect = 0.013 Identities = 26/65 (40%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 426 TAV PL+ +K LQV KY V G K R EG+RGL KG K Sbjct: 54 TAVAPLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVK 113 Query: 427 FGFYE 441 F YE Sbjct: 114 FFSYE 118 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = +1 Query: 268 PLDLVKCRLQ-----VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 432 P D VK +LQ V +YKN ++ ++ EGV+GL +G +F+G + + FG Sbjct: 34 PFDTVKVKLQKHNTDVQGLRYKNGLHCASRILQTEGVKGLYRGATSSFMGMAFESSLMFG 93 Query: 433 FYEVFKVAYAGMLDDE 480 Y K+ G L D+ Sbjct: 94 IYSQAKLFLRGTLPDD 109 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +1 Query: 268 PLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 423 P +LVKCR+Q+ +Y + ++ +V+ +GV G+ +G + T + Sbjct: 133 PTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLRECTGNAV 192 Query: 424 KFGFYEVFKVAYAGMLDD 477 F YE + L+D Sbjct: 193 FFTVYEYLRYHIHSRLED 210 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 447 PL+++K RL V E Y ++ R +G+RG G PT +G C + Y+ Sbjct: 179 PLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLPYSTCYYFMYDKM 238 Query: 448 KVAY 459 K +Y Sbjct: 239 KTSY 242 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYK---NVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 426 T PL++ + RL V A K + N+ V++EGV GL +GW + + Sbjct: 269 TISFPLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGWGASCLKVMPSSGIT 328 Query: 427 FGFYEVFK 450 + FYE +K Sbjct: 329 WVFYEAWK 336 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 41.1 bits (92), Expect = 8e-04 Identities = 29/80 (36%), Positives = 39/80 (48%), Gaps = 6/80 (7%) Frame = +1 Query: 259 AVVPLDLVKCRLQVDAEK------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 420 A+ LD+V+ R QV+ + YKN + R EG+RGL G+ P IG ++ Sbjct: 23 AMHSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTVSWG 82 Query: 421 CKFGFYEVFKVAYAGMLDDE 480 F FY K YA DDE Sbjct: 83 LYFFFYGRAKQRYARGRDDE 102 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 41.1 bits (92), Expect = 8e-04 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +1 Query: 268 PLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 PLD++K RL V +YK V + K +REEG L KG P + + G FG E Sbjct: 252 PLDVIKTRLMVQGSGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLE 311 Query: 442 VFK 450 K Sbjct: 312 KTK 314 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = +1 Query: 268 PLDLVKCRLQVD-AEKYKNVVN-GFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 P+D++K RLQ+D YK + + G KV VR EGVR L KG P +++ + G Sbjct: 33 PIDVIKTRLQLDRVGAYKGIAHCGSKV-VRTEGVRALWKGLTPFATHLTLKYTLRMGSNA 91 Query: 442 VFKVAY 459 +F+ A+ Sbjct: 92 MFQTAF 97 Score = 32.7 bits (71), Expect = 0.28 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +1 Query: 262 VVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 393 V P ++VK RLQ + KYK ++ + VREE + GL G APT Sbjct: 126 VTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPT 175 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = +1 Query: 253 PTAVVPLDLVKCRLQV---DAE---KYKNVVNGFKVSVREEGVRGLAKGWAP 390 P P D+VK RL D+E +YK +V+ + EEG+ L +G P Sbjct: 225 PFCTGPFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLP 276 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = +1 Query: 268 PLDLVKCRL----QVDA---EK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 420 PLDLV+ +L QV A E+ Y+ +V+ F + RE G RGL +G AP+ G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 Query: 421 CKFGFYEVFK 450 KF FYE K Sbjct: 193 LKFYFYEEMK 202 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +1 Query: 268 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 429 PLD+VK +LQ D K ++ + F+ V+++G RGLA+GW P + ++ + Sbjct: 252 PLDVVKTQLQCQGVCGCDRFKSSSISDVFRTIVKKDGYRGLARGWLPRMLFHAPAAAICW 311 Query: 430 GFYEVFK 450 YE K Sbjct: 312 STYETVK 318 Score = 34.3 bits (75), Expect = 0.093 Identities = 23/77 (29%), Positives = 31/77 (40%) Frame = +1 Query: 247 SDPTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 426 S P+D+VK RLQ+ YK V + K REEG + T + + Sbjct: 145 SSDAVFTPMDMVKQRLQIGNGTYKGVWDCIKRVTREEGFGAFYASYRTTVLMNAPFTAVH 204 Query: 427 FGFYEVFKVAYAGMLDD 477 F YE K ML + Sbjct: 205 FTTYEAVKRGLREMLPE 221 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 447 PLD ++ ++Q+ YK+V++ F + EGV GL +G+ P + K +++ Sbjct: 325 PLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIV 384 Query: 448 K 450 K Sbjct: 385 K 385 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 38.3 bits (85), Expect = 0.006 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 9/76 (11%) Frame = +1 Query: 265 VPLDLVKCRLQ---------VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 417 +PLD K RLQ V KY+ ++ REEG+R L KG P + G Sbjct: 30 IPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFG 89 Query: 418 LCKFGFYEVFKVAYAG 465 + G YE K Y G Sbjct: 90 GLRIGMYEPVKNLYVG 105 Score = 35.9 bits (79), Expect = 0.030 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Frame = +1 Query: 268 PLDLVKCRLQVDAE-------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 426 P DLVK RLQ + + +Y +N + VR+EGVR L G P ++ + Sbjct: 134 PTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAE 193 Query: 427 FGFYEVFK 450 Y+ K Sbjct: 194 LASYDQVK 201 Score = 35.1 bits (77), Expect = 0.053 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 396 P+D+VK R+ D+ YK ++ F +++ +G KG+ P F Sbjct: 234 PVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNF 276 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 37.9 bits (84), Expect = 0.008 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +1 Query: 259 AVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 423 A PL +VK RLQ + YK+ + + EEG+RGL G P G S + Sbjct: 130 ATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHVAI- 188 Query: 424 KFGFYEVFKVAYA 462 +F YE+ KV A Sbjct: 189 QFPTYEMIKVYLA 201 Score = 34.3 bits (75), Expect = 0.093 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +1 Query: 256 TAVVPLDLVKCRLQV-------DAE-KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 411 T V PLD++K R QV DA K +V + + EG+RGL +G +PT + Sbjct: 29 TFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLS 88 Query: 412 QGLCKFGFYEVFK 450 F Y+ K Sbjct: 89 NWAIYFTMYDQLK 101 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 37.5 bits (83), Expect = 0.010 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +1 Query: 262 VVPLDLVKCRLQVDAEK---YKNVVNGFKVSVREEGVRGLAKGWAP 390 V P D+VK LQVD K Y ++ F+ ++ EGV+GL KG+ P Sbjct: 231 VYPTDVVKSVLQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGP 276 Score = 33.9 bits (74), Expect = 0.12 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 15/84 (17%) Frame = +1 Query: 268 PLDLVKCRLQ--------------VDAEKYKNVVNGFKVSVREEG-VRGLAKGWAPTFIG 402 P +L+KCRLQ V A KY ++ + +R EG RGL KG PTF Sbjct: 124 PTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPTFAR 183 Query: 403 YSMQGLCKFGFYEVFKVAYAGMLD 474 F YE FK AG D Sbjct: 184 EVPGNATMFAAYEAFKRFLAGGSD 207 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 37.5 bits (83), Expect = 0.010 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 5/75 (6%) Frame = +1 Query: 259 AVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 423 A PL +VK RL + YK+V++ F EEGVRGL G P+ G S + Sbjct: 134 ATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVAI- 192 Query: 424 KFGFYEVFKVAYAGM 468 +F YE K A M Sbjct: 193 QFPAYEKIKQYMAKM 207 Score = 37.1 bits (82), Expect = 0.013 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +1 Query: 256 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 411 T V PLD++K RLQV ++ ++ K ++EEG RG+ +G +PT I Sbjct: 33 TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLP 92 Query: 412 QGLCKFGFYEVFK 450 F Y K Sbjct: 93 NWAVYFSVYGKLK 105 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 6/78 (7%) Frame = +1 Query: 268 PLDLVKCRLQVDAE------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 429 P ++++ +LQ + KY V++ R EG+ GL +G A + + + F Sbjct: 237 PHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITF 296 Query: 430 GFYEVFKVAYAGMLDDET 483 YE+ + ++ ET Sbjct: 297 TTYEMMLRFFRQVVPPET 314 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 36.7 bits (81), Expect = 0.017 Identities = 22/77 (28%), Positives = 37/77 (48%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 435 TA PLD +K LQ+ + + K+ ++ GVRG +G + + + KF Sbjct: 224 TATAPLDRLKVLLQIQKTDAR-IREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKFYA 282 Query: 436 YEVFKVAYAGMLDDETA 486 YE+FK A + ++ A Sbjct: 283 YELFKNAIGENMGEDKA 299 Score = 36.7 bits (81), Expect = 0.017 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNG-FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 432 T V PL +V+ R+Q AE+ + ++G F+ ++ EEG R L KG P + + Sbjct: 418 TCVYPLQVVRTRMQ--AERARTSMSGVFRRTISEEGYRALYKGLLPNLLKVVPAASITYM 475 Query: 433 FYEVFK 450 YE K Sbjct: 476 VYEAMK 481 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 36.7 bits (81), Expect = 0.017 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +1 Query: 268 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 P DL++ L Q + + Y N+ + F V+ G++GL G +PT I +FG Y+ Sbjct: 146 PFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYD 205 Query: 442 VFK 450 FK Sbjct: 206 TFK 208 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 36.3 bits (80), Expect = 0.023 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 265 VPLDLVKCRLQV-DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 +PLD ++ +L E + F+ ++ EG+ L KG P+ ++ G +G Y+ Sbjct: 160 LPLDTIRTKLVARGGEALGGIGGAFRYMIQTEGLFSLYKGLVPSIASMALSGAVFYGVYD 219 Query: 442 VFKVAY 459 + K ++ Sbjct: 220 ILKSSF 225 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.9 bits (79), Expect = 0.030 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 396 P+D+VK R+ D+ Y+N V+ F +++ EG+ KG+ P F Sbjct: 236 PIDVVKSRMMGDST-YRNTVDCFIKTMKTEGIMAFYKGFLPNF 277 Score = 34.3 bits (75), Expect = 0.093 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +1 Query: 265 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 414 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 415 GLCKFGFYEVFKVAYAG 465 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 35.1 bits (77), Expect = 0.053 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +1 Query: 268 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 P DL++ L Q + + Y + + F ++ G+RGL G PT + +FG Y+ Sbjct: 151 PFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYD 210 Query: 442 VFK 450 +FK Sbjct: 211 MFK 213 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 35.1 bits (77), Expect = 0.053 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 259 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 438 A PLD+VK RLQ Y+ + + F+ SV++EG L +G + F Y Sbjct: 217 ACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAY 276 Query: 439 EV 444 EV Sbjct: 277 EV 278 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 34.7 bits (76), Expect = 0.070 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 9/77 (11%) Frame = +1 Query: 271 LDLVKCRLQVDAEK--------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 426 LD + RL DA++ +K +++ ++ ++ +G++GL +G+ + +G ++ Sbjct: 136 LDYARTRLGTDAKECSVNGKRQFKGMIDVYRKTLSSDGIKGLYRGFGVSIVGITLYRGMY 195 Query: 427 FGFYEVFK-VAYAGMLD 474 FG Y+ K + G L+ Sbjct: 196 FGMYDTIKPIVLVGSLE 212 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 34.7 bits (76), Expect = 0.070 Identities = 21/68 (30%), Positives = 30/68 (44%) Frame = +1 Query: 247 SDPTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 426 S P+D+VK RLQ+ YK V + K +REEG+ + T + + Sbjct: 143 SSDAVFTPMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVH 202 Query: 427 FGFYEVFK 450 F YE K Sbjct: 203 FATYEAAK 210 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Frame = +1 Query: 268 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 429 PLD+VK +LQ D ++ + + V+++G RGL +GW P + ++ + Sbjct: 247 PLDVVKTQLQCQGVCGCDRFTSSSISHVLRTIVKKDGYRGLLRGWLPRMLFHAPAAAICW 306 Query: 430 GFYEVFKVAYAGM-LDDETA 486 YE K + +D TA Sbjct: 307 STYEGVKSFFQDFNVDSNTA 326 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 34.3 bits (75), Expect = 0.093 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 435 + V PL +++ R+Q D+ K ++ F ++R EG++G +G P F + Sbjct: 409 SCVYPLQVIRTRMQADSSK-TSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLV 467 Query: 436 YEVFK 450 YE K Sbjct: 468 YEAMK 472 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/70 (31%), Positives = 29/70 (41%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 435 TA PLD +K LQV VV K RE+ + G +G + + KF Sbjct: 220 TATAPLDRLKVALQVQRTNL-GVVPTIKKIWREDKLLGFFRGNGLNVAKVAPESAIKFAA 278 Query: 436 YEVFKVAYAG 465 YE+ K G Sbjct: 279 YEMLKPIIGG 288 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +1 Query: 256 TAVVPLDLVKCRLQ--VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 429 TA+ P+DLVK RLQ V + K +EG R +G P+ IG Sbjct: 311 TAIYPMDLVKTRLQTFVSEVGTPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIPYAGIDL 370 Query: 430 GFYEVFK 450 YE K Sbjct: 371 AAYETLK 377 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 34.3 bits (75), Expect = 0.093 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +1 Query: 265 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 414 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 415 GLCKFGFYEVFKVAYAG 465 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 33.5 bits (73), Expect = 0.16 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 268 PLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 405 PLD+VK RLQV KYK ++ R+EG +G +G P + Y Sbjct: 271 PLDVVKTRLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWY 318 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 33.1 bits (72), Expect = 0.21 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 435 + V PL +V+ R+Q D+ K + F +++ EG+RG +G P + + Sbjct: 410 SCVYPLQVVRTRMQADSSK-TTMKQEFMNTMKGEGLRGFYRGLLPNLLKVVPAASITYIV 468 Query: 436 YEVFK 450 YE K Sbjct: 469 YEAMK 473 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 3/68 (4%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFIGYSMQGLCK 426 TA+ P+DLVK RLQ + +K++ EG R KG P+ +G Sbjct: 312 TAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIVPYAGID 371 Query: 427 FGFYEVFK 450 YE K Sbjct: 372 LAAYETLK 379 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 33.1 bits (72), Expect = 0.21 Identities = 24/57 (42%), Positives = 28/57 (49%) Frame = +1 Query: 514 RRLRRRNSSPTSPCRPWRRLRSVSKPCLVSRAPSARRGRRWSRTKLRHVLQGPGAAL 684 R R S S RP R RS S P VS PS RGR SR++ R ++ PG L Sbjct: 20 RARSRSRSRSRSRSRPRLRSRSRSLPRPVS--PSRSRGRSRSRSRGRSEVENPGTTL 74 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 33.1 bits (72), Expect = 0.21 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNG----FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 435 PLD+VK RLQ+ + + G F ++ EG R L G P + G + G Sbjct: 83 PLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTRSVLYGGLRLGL 142 Query: 436 YEVFKVAY 459 YE KV++ Sbjct: 143 YEPTKVSF 150 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = +1 Query: 268 PLDLVKCRLQV--DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 PLD +K RLQV E + K + E+G +G +G P F S G YE Sbjct: 254 PLDTIKTRLQVMGHQENRPSAKQVVKKLLAEDGWKGFYRGLGPRFFSMSAWGTSMILTYE 313 Query: 442 VFK 450 K Sbjct: 314 YLK 316 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 32.7 bits (71), Expect = 0.28 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +1 Query: 268 PLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 P D+VK R+ E Y+N + +V+ EG+R L KG+ PT+ + YE Sbjct: 235 PADVVKTRMMNQGENAVYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYE 294 Query: 442 VFKV 453 F++ Sbjct: 295 KFRL 298 Score = 31.5 bits (68), Expect = 0.66 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +1 Query: 268 PLDLVKCRLQVDAE--------KYKNVVNGFKVSVREEGVRGLAKGWAP 390 P DLVK R+Q D +Y + F ++ EGV+GL KG P Sbjct: 134 PADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 390 PLD V+ ++Q+ YK++ F + +G+ GL +G+ P Sbjct: 297 PLDTVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLP 337 Score = 29.1 bits (62), Expect = 3.5 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 8/83 (9%) Frame = +1 Query: 256 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 411 T PLD +K +Q A+K + + +EEGV+G KG P I Sbjct: 103 TVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLP 162 Query: 412 QGLCKFGFYEVFKVAYAGMLDDE 480 + YE +K + G DD+ Sbjct: 163 YSAVQLLAYESYKNLFKGK-DDQ 184 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 31.5 bits (68), Expect = 0.66 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 6/53 (11%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 396 TA PLDLV+ R+QV+ A Y + G FK + EG +G+ +G P + Sbjct: 259 TATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEY 311 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 31.5 bits (68), Expect = 0.66 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNGFKVSV-REEGVRGLAKGWAPTFIGYSMQGLCKFGFYEV 444 P D++K R+ ++ VS+ R EG GL KG P F + G F YE+ Sbjct: 741 PFDVMKTRMMTATPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAPLGAMNFAGYEL 800 Query: 445 FKVA 456 K A Sbjct: 801 AKKA 804 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +1 Query: 259 AVVPLDLVKCRLQV---DAEKYKNVVNGFKVSVREEGVRGLAKG 381 A P+D V+ R+ + +A KYK+ + F V++EG + L KG Sbjct: 307 ASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKG 350 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 408 TA P++ VK +Q E YK + + F ++R+EG+ L +G I Y Sbjct: 100 TAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYF 159 Query: 409 MQGLCKFGFYEVFK 450 F F + FK Sbjct: 160 PTQALNFAFKDYFK 173 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +1 Query: 313 YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 450 Y + ++ +E G RGL +G PT IG KF YE K Sbjct: 171 YSGIKEVLAMAYKEGGPRGLYRGIGPTLIGILPYAGLKFYIYEELK 216 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 399 T +P +++K RLQ A ++ N+V + +EG++GL +G T + Sbjct: 133 TLRIPCEVLKQRLQ--ANQFDNIVEATVSTWHQEGLKGLFRGTGVTLL 178 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 259 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 402 A+ P L+K R QV + + F + VR EG+RGL +G+ + +G Sbjct: 44 ALYPAVLMKTRQQVCHSQGSCIKTAFTL-VRHEGLRGLYRGFGTSLMG 90 >At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 730 Score = 29.5 bits (63), Expect = 2.6 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%) Frame = +1 Query: 301 DAEKYKNVVNGF----KVSVREEGV-RGLAKGWAPTFI--GYSMQGLCKFGFYEVFK 450 DAE + +V+ G +++ + V R L +G+AP I GY M GLCK G + K Sbjct: 286 DAETFNDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAK 342 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +2 Query: 623 VAEDGQERSYGTFYKGLVPLWGRQIPYTMMKFACFER 733 VAE+G YKGLVP RQ P+TM+ F E+ Sbjct: 295 VAEEGPM----ALYKGLVPTATRQGPFTMILFLTLEQ 327 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 268 PLDLVKCRLQ-VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 393 P+D+VK R+ D E Y ++ V EEG L KG PT Sbjct: 268 PIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPT 310 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 29.5 bits (63), Expect = 2.6 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 9/74 (12%) Frame = +1 Query: 256 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 408 TA P++ VK +Q +E YK + + F +V++EG+ L +G I Y Sbjct: 95 TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTANVIRYF 154 Query: 409 MQGLCKFGFYEVFK 450 F F + FK Sbjct: 155 PTQALNFAFKDYFK 168 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 346 VREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 450 +REEG+R L G + T + ++ + G Y++ K Sbjct: 72 IREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIK 106 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 656 TFYKGLVPLWGRQIPYTMMKFACFER 733 + YKG +P RQ P+T++ F E+ Sbjct: 278 SLYKGFIPTVSRQAPFTVVLFVTLEQ 303 >At1g74960.2 68414.m08700 3-ketoacyl-ACP synthase, putative similar to 3-ketoacyl-ACP synthase [Cuphea pulcherrima] gi|3800747|gb|AAC68860; identical to cDNA beta-ketoacyl-ACP synthetase 2 nuclear gene for plastid product GI:14582700 Length = 541 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 502 FVSWRRLRRRNSSPTSPCRPW 564 FV+ R L +RN+ PT RPW Sbjct: 331 FVACRALSQRNNDPTKASRPW 351 >At1g74960.1 68414.m08699 3-ketoacyl-ACP synthase, putative similar to 3-ketoacyl-ACP synthase [Cuphea pulcherrima] gi|3800747|gb|AAC68860; identical to cDNA beta-ketoacyl-ACP synthetase 2 nuclear gene for plastid product GI:14582700 Length = 541 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 502 FVSWRRLRRRNSSPTSPCRPW 564 FV+ R L +RN+ PT RPW Sbjct: 331 FVACRALSQRNNDPTKASRPW 351 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 28.7 bits (61), Expect = 4.6 Identities = 24/57 (42%), Positives = 27/57 (47%) Frame = +1 Query: 514 RRLRRRNSSPTSPCRPWRRLRSVSKPCLVSRAPSARRGRRWSRTKLRHVLQGPGAAL 684 R R S S RP R RS S P VS PS RGR SR++ V + PG L Sbjct: 20 RARSRSRSRSRSRSRPRLRSRSRSLPRPVS--PSRSRGRSRSRSRGSEV-ENPGTTL 73 >At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 819 Score = 28.7 bits (61), Expect = 4.6 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 10/103 (9%) Frame = +1 Query: 229 WCSVMRSDPTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEG-----VRGLAKGWAPT 393 +C D + + L + + + D Y +++G VS + V+ + +G +P Sbjct: 390 YCKSKEYDIASKLLLQMAERGCKPDIVTYGILIHGLVVSGHMDDAVNMKVKLIDRGVSPD 449 Query: 394 FIGYSM--QGLCKFGFYEVFKVAYAGMLDDE---TAYTYRTFV 507 Y+M GLCK G + K+ ++ MLD AY Y T + Sbjct: 450 AAIYNMLMSGLCKTGRFLPAKLLFSEMLDRNILPDAYVYATLI 492 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = +1 Query: 262 VVPLDLVKCRLQVD-----AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 426 V PLD+ RL D A +++ + + +++GVRG+ +G + G + Sbjct: 159 VYPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASLHGVIIHRGLY 218 Query: 427 FGFYEVFKVAYA 462 FG ++ K ++ Sbjct: 219 FGGFDTVKEIFS 230 >At5g46290.1 68418.m05698 3-oxoacyl-[acyl-carrier-protein] synthase I identical to Swiss-Prot:P52410 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplast precursor (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase I) (KAS I) [Arabidopsis thaliana] Length = 473 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 502 FVSWRRLRRRNSSPTSPCRPWRRLR 576 FV+ R L +RN P + RPW + R Sbjct: 263 FVACRALSQRNDDPQTASRPWDKAR 287 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 243 HDRTPPTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDW 109 H + P PQ + D N+ + + A+ A+ S ATG VDW Sbjct: 151 HQQQNPNPQHQQR--DANNPAGLLSIAEEALAEFLSKATGTAVDW 193 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 347 TDTLKPFTTFLYFSASTWRRHFTRSRG 267 +D+ KPF+TF ++ W RH T +RG Sbjct: 263 SDSSKPFSTFQSLTSHIW-RHVTLARG 288 >At4g15010.3 68417.m02307 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 8.1 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 2/119 (1%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 442 VFKVAYAGMLDDETAYTYRTFVSWRRLRRRNSSPTSPCRPWRRLRSVSKPCLVSRAPSA 618 + Y D F++ ++ T P+ ++ + SRAP+A Sbjct: 90 ILTAFYKDGRHDNYVSVGEAFLAG---LVGGAAETVMTSPFELIKVRKQVTAASRAPNA 145 >At4g15010.2 68417.m02306 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 8.1 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 2/119 (1%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 442 VFKVAYAGMLDDETAYTYRTFVSWRRLRRRNSSPTSPCRPWRRLRSVSKPCLVSRAPSA 618 + Y D F++ ++ T P+ ++ + SRAP+A Sbjct: 90 ILTAFYKDGRHDNYVSVGEAFLAG---LVGGAAETVMTSPFELIKVRKQVTAASRAPNA 145 >At4g15010.1 68417.m02305 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 8.1 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 2/119 (1%) Frame = +1 Query: 268 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 441 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 442 VFKVAYAGMLDDETAYTYRTFVSWRRLRRRNSSPTSPCRPWRRLRSVSKPCLVSRAPSA 618 + Y D F++ ++ T P+ ++ + SRAP+A Sbjct: 90 ILTAFYKDGRHDNYVSVGEAFLAG---LVGGAAETVMTSPFELIKVRKQVTAASRAPNA 145 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,029,605 Number of Sequences: 28952 Number of extensions: 382076 Number of successful extensions: 1394 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1383 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -