BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021858 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 55 7e-10 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 55.2 bits (127), Expect = 7e-10 Identities = 25/58 (43%), Positives = 36/58 (62%) Frame = +3 Query: 333 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G++L+ Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLM 237 Score = 36.3 bits (80), Expect = 3e-04 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Frame = +1 Query: 514 QTGSGKTLAYILPAIVHINNQPP----IRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 681 QTGSGKT A+ +P I + + P ++++PTREL QI Q F S Sbjct: 241 QTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNS 300 Query: 682 YVRNTCVFGG 711 ++ +GG Sbjct: 301 ILKTVVAYGG 310 Score = 27.5 bits (58), Expect = 0.15 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 728 QARDLEKGSRNSIATPGRLIDFLE 799 Q L G +ATPGRL+DF+E Sbjct: 316 QRGKLSAGCHILVATPGRLLDFVE 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,140 Number of Sequences: 438 Number of extensions: 4484 Number of successful extensions: 13 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -