BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021856 (805 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 23 3.8 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 22 6.6 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 22 6.6 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 257 FFLHNII*KSKPCIIFNLY 313 FF N+I S+ C++ N+Y Sbjct: 43 FFKKNLIVGSENCLVLNVY 61 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +1 Query: 295 HHF*LV*IRVMLQCLEMCEFERCEVSDAISIW 390 H F I ML CL F C +++W Sbjct: 207 HTFGYYHILAMLNCLCSLWFINCTAKGRVAVW 238 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +1 Query: 295 HHF*LV*IRVMLQCLEMCEFERCEVSDAISIW 390 H F I ML CL F C +++W Sbjct: 207 HTFGYYHILAMLNCLCSLWFINCTAKGRVAVW 238 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,363 Number of Sequences: 336 Number of extensions: 2491 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -