BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021856 (805 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 27 2.4 SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyce... 27 4.1 SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pomb... 26 5.5 SPAC227.16c |||GINS complex subunit Psf3|Schizosaccharomyces pom... 25 9.5 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 27.5 bits (58), Expect = 2.4 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 337 LEMCEFERCEVSDAISIWQQLAESD*KQVLNVLKNSDLIRDHY 465 L C+FE + + ISI+ D +V VL + DHY Sbjct: 1100 LSSCKFEGYDPQNLISIYPPARFGDVTEVTKVLNRESVKLDHY 1142 >SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 330 Score = 26.6 bits (56), Expect = 4.1 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 671 ECRSPVASTSRDDVDSAQQLYATLNEYLLLDKS 769 E +S VAS S+D+V S+ L + + LL D+S Sbjct: 148 EQKSSVASASKDNVSSSSILQGSASSKLLPDQS 180 >SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pombe|chr 1|||Manual Length = 414 Score = 26.2 bits (55), Expect = 5.5 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 387 LATARGV*LKTSFKCIKELGFDP*SLH*FSAYEVLGPSRPVS-SRRVVEQRGDRH 548 LA G L+T KC+K++ FD S + +S R+V+ Q GD H Sbjct: 145 LANCNG--LRTITKCVKDVSFDEFRKDVISCSTIENKIMAISFCRKVLGQTGDGH 197 >SPAC227.16c |||GINS complex subunit Psf3|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 25.4 bits (53), Expect = 9.5 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +2 Query: 503 PGLKSSGRRAEGGSARAYTTTLAAACSAHA*VPIHPPLAPTVPIMLRAGARHPDAAECR 679 PGL GR GS LA + ++ V IH P AP ++ A +P++ R Sbjct: 25 PGLGHEGRMVPTGSKVELPFWLAEVLAINSFVSIHMP-APFSSVVRNALKANPNSVSIR 82 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,517,639 Number of Sequences: 5004 Number of extensions: 43844 Number of successful extensions: 117 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 390427050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -