BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021856 (805 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40420-1|AAA81430.1| 2214|Caenorhabditis elegans Hypothetical pr... 29 5.1 U97015-6|AAB52345.2| 1064|Caenorhabditis elegans Hypothetical pr... 28 6.8 >U40420-1|AAA81430.1| 2214|Caenorhabditis elegans Hypothetical protein F40F4.6 protein. Length = 2214 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 623 TVPIMLRAGARHPDAAECRSP 685 TVPI + G R+PD A C P Sbjct: 1501 TVPICVNGGTRNPDEATCSCP 1521 >U97015-6|AAB52345.2| 1064|Caenorhabditis elegans Hypothetical protein F48C1.1 protein. Length = 1064 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/60 (25%), Positives = 31/60 (51%) Frame = +2 Query: 11 LVRSYVRHLLSYFASLNLTFFVVLTEYTYSFIYNLIKHH*RASVKKFLNLRSLFKFSENL 190 L S R +L ++++ FF +L + ++ L +H+ + + +N+RS K + NL Sbjct: 22 LALSAKRKVLLNPKTVSIYFFAILFTFLLAYHQRLGQHNNELHISRVVNMRSFVKEANNL 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,208,695 Number of Sequences: 27780 Number of extensions: 262603 Number of successful extensions: 777 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1966828226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -