BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021855 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18599| Best HMM Match : No HMM Matches (HMM E-Value=.) 237 7e-63 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 31 0.80 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 30 2.4 SB_54895| Best HMM Match : S1 (HMM E-Value=4.3) 29 5.6 SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_18599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 237 bits (580), Expect = 7e-63 Identities = 122/174 (70%), Positives = 128/174 (73%) Frame = +3 Query: 255 LISLLEAALGLERAHMGMFTELAILYSKYKPVKMREHLELFWSRVNIPKVLRAAEHAHLW 434 LI L+EAALGLERAHMGMFTELAILYSKYKP KMREHLELFWSRVNIPKVLRAAE AHLW Sbjct: 1124 LIGLMEAALGLERAHMGMFTELAILYSKYKPSKMREHLELFWSRVNIPKVLRAAEQAHLW 1183 Query: 435 SELVFLYDKYEEYDNAALTMMQHPTRLGARDTSKT*SLKSRTWNCTTKLSNFT*TTSHFL 614 SELVFLY+KYEEYDNA TMMQHPT K K + F L Sbjct: 1184 SELVFLYEKYEEYDNAVQTMMQHPTVAWKEGLFKDVICKVANIELYYRSLQFYLDFKPML 1243 Query: 615 LNDLLLVLAPRMDHTRAVNFFTKAGHLQLVKAYLRSVQSLNNKAVNEALTRCLL 776 LNDLLLVL PRMDHTRAV FF K HL LVK YLRSVQS NNK++NEAL L+ Sbjct: 1244 LNDLLLVLTPRMDHTRAVAFFAKVKHLPLVKPYLRSVQSHNNKSINEALNDLLI 1297 Score = 159 bits (385), Expect = 3e-39 Identities = 70/85 (82%), Positives = 79/85 (92%) Frame = +1 Query: 1 AKLLYNNVSNFARLAITLVHLKEFQGAVDSARKANSTRTWKEVCFACVDAGEFRLAQMCG 180 AKLLYNN+SNFA+LA TLVHL E+Q AVD ARKANST+TWKEVCFACVD GEFR+AQMCG Sbjct: 1039 AKLLYNNISNFAKLASTLVHLGEYQAAVDGARKANSTKTWKEVCFACVDGGEFRMAQMCG 1098 Query: 181 LHIVVHADELEDLINYYQDRGHFDD 255 LHIVVHADELE+LINYYQ+RG F++ Sbjct: 1099 LHIVVHADELEELINYYQNRGFFEE 1123 >SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) Length = 1066 Score = 31.5 bits (68), Expect = 0.80 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +1 Query: 55 VHLKEFQGAVDSARKANSTRTWKEVCFACVDAGEFRLAQMCGLHIVVHADELEDLINYYQ 234 + L E + A + A +A R WK++ + +F+LAQ C LH HA + L+ Sbjct: 546 IQLGELRTAYEIAMEAEVERKWKQLAELAISKCQFQLAQEC-LH---HAQDFGGLLLLAT 601 Query: 235 DRGHFD 252 G D Sbjct: 602 SSGDAD 607 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -3 Query: 540 MSLKCPSRQASWDAASS*EQRCHTPHTCHTGIPALTKDGHVQQHGV 403 +S+KC S ++ +S + HTPH T +P D H ++ + Sbjct: 1949 LSVKCASHSSNSSTTTSSQDSPHTPHLT-TSVPYAQMDNHTSKNNL 1993 >SB_54895| Best HMM Match : S1 (HMM E-Value=4.3) Length = 479 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/58 (34%), Positives = 24/58 (41%) Frame = +2 Query: 8 SCITTSATSPVLLLLWCI*KNFKVPWTARVRPTLRAHGRRSASRAWTPVNSDSRKCAD 181 S TTS + P C ++ VP V +AH AS W PV SRK D Sbjct: 254 SAATTSTSLPPASKKLC--RSLSVPAEETVELQEQAHWIPRASNVWQPVKGMSRKRTD 309 >SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 142 VDAGEFRLAQMCGLHIVVHADELEDLINYY 231 ++A E R +CG+ + DEL+D++ YY Sbjct: 238 IEASELR-DLLCGMEKKIPEDELQDMLRYY 266 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,434,328 Number of Sequences: 59808 Number of extensions: 457810 Number of successful extensions: 1322 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1310 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -