BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021851 (667 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 27 0.16 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.6 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.0 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.0 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.0 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 8.0 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 8.0 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 27.1 bits (57), Expect = 0.16 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +3 Query: 360 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLF 512 +DT+ K KI K I PD + L+ KQ E G TL I + F Sbjct: 732 TDTVLAYKPKILGKPTISPDSRHLVTLDKQ-ETGVTLVVQEISSDGLKFAF 781 Score = 26.6 bits (56), Expect = 0.21 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 133 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 243 +DT+ K KI K I PD + L+ KQ E G TL Sbjct: 732 TDTVLAYKPKILGKPTISPDSRHLVTLDKQ-ETGVTL 767 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 316 TKICMPPRSLKTKCRVDSFW 257 T + +PP K+ C++D W Sbjct: 135 TCLYVPPGIFKSTCKIDITW 154 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 304 MPPRSLKTKCRVDSFW 257 +PP K+ C++D W Sbjct: 102 VPPGIFKSTCKIDIAW 117 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 304 MPPRSLKTKCRVDSFW 257 +PP K+ C++D W Sbjct: 102 VPPGIFKSTCKIDITW 117 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 304 MPPRSLKTKCRVDSFW 257 +PP K+ C++D W Sbjct: 102 VPPGIFKSTCKIDITW 117 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 304 MPPRSLKTKCRVDSFW 257 +PP K+ C++D W Sbjct: 170 VPPGIFKSTCKIDITW 185 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 304 MPPRSLKTKCRVDSFW 257 +PP K+ C++D W Sbjct: 170 VPPGIFKSTCKIDITW 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,699 Number of Sequences: 438 Number of extensions: 3602 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -