BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021846 (804 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0629 - 5183504-5184970 31 1.1 12_02_0343 - 17748882-17753396 30 1.9 01_04_0045 + 15392817-15392963,15393108-15393156,15393463-15393911 30 2.5 03_02_0528 + 9189215-9189330,9190111-9190204,9190654-9190743,919... 29 3.3 01_07_0080 - 40955222-40955676,40956123-40956171,40956282-40956443 29 4.3 02_05_0366 - 28313190-28313601,28313759-28314225,28315044-283157... 29 5.7 12_01_0063 - 535364-536085,536226-536439,536989-537981,538238-53... 28 7.6 11_01_0061 - 456521-457389,457534-457659,458377-459307,459564-45... 28 7.6 02_05_0856 - 32272757-32273494,32273578-32273866,32273961-322743... 28 7.6 02_05_0554 + 29929860-29929959,29932944-29934220 28 7.6 03_04_0055 + 16891212-16891848,16893166-16893206 28 10.0 03_03_0196 + 15331604-15331646,15332141-15332260,15334106-153342... 28 10.0 >12_01_0629 - 5183504-5184970 Length = 488 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 492 QVDLGRFVYAGMYDYLKAMLQKPDLEQKYPAFRKPIEAVLAIPKVKAY 635 +VD+G+ +Y GM+D L +L D + I A+LA P + Sbjct: 166 EVDIGQVLYHGMFDLLANVLLSVDAHPNLRDLMEDIVAILAKPNASDF 213 >12_02_0343 - 17748882-17753396 Length = 1504 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = -1 Query: 330 LHVLVDLEGL--LVIGPGESVLA--TEVPEMAVLWAYCLPSISSTGI*PNGV 187 LH+L +E L +S+ A +++P + LW C P+ISS G PN + Sbjct: 1372 LHILTSIEDLEFYCCEKLQSLPAELSQIPTIKTLWISCCPAISSLGNLPNSL 1423 >01_04_0045 + 15392817-15392963,15393108-15393156,15393463-15393911 Length = 214 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Frame = +2 Query: 62 VKFYYFPVKALGESQRLLLAYGGQEFE----DNRISSENWPEFKPKTPFGQMPVLEIDGK 229 +K Y P+ + L G+++E D I+ PE + PFGQ+P L+ Sbjct: 3 MKVYGLPMSTNVARVLVCLEEAGEQYEVVPIDFSIAEHKSPEHTSRNPFGQVPALQDGDL 62 Query: 230 QYAQSTAIS 256 +S AIS Sbjct: 63 ILFESRAIS 71 >03_02_0528 + 9189215-9189330,9190111-9190204,9190654-9190743, 9191601-9191717,9192187-9192259,9192335-9192453, 9192569-9192690,9192777-9192953,9193189-9193333, 9193458-9193636,9193742-9193991 Length = 493 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 188 TPFGQMPVLEIDGKQYAQSTAISGTSVASTDS 283 TP+G++ V E +GK AI +SVA D+ Sbjct: 444 TPWGELEVYEYNGKYTEHRAAIDSSSVADDDT 475 >01_07_0080 - 40955222-40955676,40956123-40956171,40956282-40956443 Length = 221 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 143 DNRISSENWPEFKPKTPFGQMPVLEIDGKQYAQSTAIS 256 D R ++ P F PFGQ+PVL+ + +S AI+ Sbjct: 39 DLRTAAHKQPHFLALNPFGQIPVLQDGDEVLYESRAIN 76 >02_05_0366 - 28313190-28313601,28313759-28314225,28315044-28315782, 28316548-28316615,28316693-28316757,28316922-28320162, 28320239-28320301,28320756-28320824,28321020-28321055, 28322035-28322280,28322531-28322569,28322695-28322816, 28322921-28323004,28323100-28323235,28323486-28323535, 28323620-28323756,28323863-28323951,28324847-28324954, 28325080-28325163,28325841-28325888,28326036-28326153, 28328262-28328347 Length = 2168 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 444 ETQ*DTDEEQRSYRAWQVDLGRFVYAGMYDYLKAMLQKPDLEQK 575 E + D D+E SY +W VD Y +++A+ QK E++ Sbjct: 1572 EAEIDEDQEPLSYESWDVDFATTAYR---QHVEALAQKQLFEEQ 1612 >12_01_0063 - 535364-536085,536226-536439,536989-537981,538238-538255, 538601-538860,539950-540073,540978-541310,541447-541531, 541683-541768,541843-541941,542041-542180,542717-543043, 543163-543774,543887-543971,543972-544067,544147-544500, 544536-544559,544597-544707,544811-544894,545468-545546, 546122-546279,546412-546528,546622-546780,546857-546939, 547525-547627,549184-549495 Length = 1925 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/63 (23%), Positives = 27/63 (42%) Frame = +2 Query: 35 LHNNPTMPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKPKTPFGQMPVL 214 L +PT+ VK + ++R+L Y G + E W K T + +P+ Sbjct: 171 LQLDPTLEEVKKLCNTCRKFARTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPIT 230 Query: 215 EID 223 ++D Sbjct: 231 DLD 233 >11_01_0061 - 456521-457389,457534-457659,458377-459307,459564-459581, 459924-460183,461834-461918,462587-462919,463053-463137, 463289-463374,463455-463556,463656-463795,464332-464658, 464778-465389,465502-465586,465587-465682,465762-466115, 466212-466322,466426-466509,467086-467164,467742-467899, 468034-468150,468240-468398,468475-468557,469098-469200, 470784-471080 Length = 1899 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/63 (23%), Positives = 27/63 (42%) Frame = +2 Query: 35 LHNNPTMPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKPKTPFGQMPVL 214 L +PT+ VK + ++R+L Y G + E W K T + +P+ Sbjct: 166 LQLDPTLEEVKKLCNTCRKFARTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPIT 225 Query: 215 EID 223 ++D Sbjct: 226 DLD 228 >02_05_0856 - 32272757-32273494,32273578-32273866,32273961-32274312, 32275232-32275850 Length = 665 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +1 Query: 196 RSDAGAGDR-RQAVRPEHRHLRYLGR 270 R DA GDR RQA++ HRH R++ R Sbjct: 188 RQDAHGGDRGRQALQGGHRHGRFMMR 213 >02_05_0554 + 29929860-29929959,29932944-29934220 Length = 458 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 279 SVLATEVPEMAVLWAYCLPSISSTGI*PNGVLGLNSGQFS 160 S+L P + + YCLPS SS+G G N GQ+S Sbjct: 260 SLLYQLAPSLGYSFTYCLPSSSSSGYLSLG--SYNPGQYS 297 >03_04_0055 + 16891212-16891848,16893166-16893206 Length = 225 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 215 EIDGKQYAQSTAISGTSVASTDSP 286 EI+G++ A ST +GTS AST P Sbjct: 113 EIEGERAAASTTGAGTSAASTTPP 136 >03_03_0196 + 15331604-15331646,15332141-15332260,15334106-15334221, 15334661-15334749,15334885-15334927,15335567-15335741, 15335840-15335971,15336046-15336383,15336791-15337129, 15337293-15337975,15338228-15338807,15339356-15339679, 15340149-15340262 Length = 1031 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 348 ANVVQELHVLVDLEGLLVIGPGESVL 271 AN + E+H+ + LE LL +GP ++ L Sbjct: 550 ANGINEMHLQIRLEKLLTLGPDDNQL 575 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,206,698 Number of Sequences: 37544 Number of extensions: 326491 Number of successful extensions: 987 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2185924824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -