BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021846 (804 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19919| Best HMM Match : GST_N (HMM E-Value=4.7e-22) 66 4e-11 SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) 64 1e-10 SB_37695| Best HMM Match : GST_N (HMM E-Value=2.4e-24) 58 6e-09 SB_28555| Best HMM Match : GST_N (HMM E-Value=3.5e-18) 51 1e-06 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 33 0.36 SB_54755| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_48679| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_25424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 >SB_19919| Best HMM Match : GST_N (HMM E-Value=4.7e-22) Length = 79 Score = 65.7 bits (153), Expect = 4e-11 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +2 Query: 53 MPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKPK--TPFGQMPVLEIDG 226 MP+ K YYF + E RL+ A G EFEDNR++ WP+ K + PFGQ+P+L ID Sbjct: 1 MPSYKLYYFNARGRAEPARLVFAAAGIEFEDNRMAMGEWPKVKKELHAPFGQVPLLVIDD 60 Query: 227 K-QYAQSTAI 253 K + AQS AI Sbjct: 61 KIKLAQSLAI 70 >SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) Length = 221 Score = 64.5 bits (150), Expect = 1e-10 Identities = 32/69 (46%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Frame = +2 Query: 53 MPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKP--KTPFGQMPVLEIDG 226 MPN K YF + E RL A GG +ED R++ E W + K KT G +PVLE+DG Sbjct: 1 MPNYKLIYFNTRGRAEPTRLCFAAGGIPYEDVRLTGEEWTKMKAENKTIMGYLPVLEVDG 60 Query: 227 KQYAQSTAI 253 QY +S AI Sbjct: 61 IQYCESMAI 69 >SB_37695| Best HMM Match : GST_N (HMM E-Value=2.4e-24) Length = 102 Score = 58.4 bits (135), Expect = 6e-09 Identities = 37/81 (45%), Positives = 45/81 (55%), Gaps = 4/81 (4%) Frame = +2 Query: 23 NYSLLHNNPTMPNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISS-ENWPEFKPK--TP 193 N SLL P MP+ K +YF + E RL A G E+ED R E W KP+ P Sbjct: 14 NISLLPF-PKMPSYKLHYFNARGRAEPARLAFAAAGIEYEDKRFEGREEWLRVKPELDPP 72 Query: 194 FGQMPVLEIDGK-QYAQSTAI 253 FGQ+P+L ID K + AQS AI Sbjct: 73 FGQVPLLVIDDKIKLAQSMAI 93 >SB_28555| Best HMM Match : GST_N (HMM E-Value=3.5e-18) Length = 195 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = +2 Query: 56 PNVKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKP--KTPFGQMPVLEI-DG 226 P + YF +A E R+LL F D R++ +W K + PFG++P+LEI DG Sbjct: 3 PTYRVVYFDARARAECIRVLLHLADVPFTDERVAPPDWAAMKTSGRCPFGELPLLEISDG 62 Query: 227 KQYAQSTAI 253 ++ AQS AI Sbjct: 63 RKLAQSHAI 71 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 32.7 bits (71), Expect = 0.36 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +2 Query: 98 ESQRLLLAYGGQEFEDNRISSENWPEFKPKTPFGQMPVLEIDGKQYAQSTAISGTSVAST 277 E QRL+L +E + NR ++ W E P P +LEI +Q Q A + S Sbjct: 768 ERQRLILEQQERE-QQNRAAAAGWGEHAPVGPPPVKSLLEIQEEQARQQKAKAQNQQLSR 826 Query: 278 DSPGP 292 P P Sbjct: 827 SQPAP 831 >SB_54755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 74 YFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFK 181 YF V+A GE R+LL F + R E+WP K Sbjct: 95 YFDVRARGECIRVLLHLADVPFTEERHGLEDWPAVK 130 >SB_48679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 214 GDRRQA-VRPEHRHLRYLGRKYGLAGANDEEAFEID 318 GD++ + + LRY+GRKY + G +EE +D Sbjct: 10 GDKKHIKITQSNAILRYIGRKYDMCGKTEEEKVIVD 45 >SB_25424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +2 Query: 62 VKFYYFPVKALGESQRLLLAYGGQEFEDNRISSENWPEFKPK 187 V +YF + E RL++ G + + + E+WP K K Sbjct: 54 VTLHYFGSRGKAEGIRLMMEDNGVLYAETNYTKEDWPTVKQK 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,833,810 Number of Sequences: 59808 Number of extensions: 356885 Number of successful extensions: 929 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2227723674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -