BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021845 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 25 1.7 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 3.0 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 6.9 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 6.9 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 6.9 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 6.9 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 6.9 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 9.1 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 9.1 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 9.1 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 9.1 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 9.1 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 9.1 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 9.1 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 9.1 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 9.1 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 9.1 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 9.1 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 9.1 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 9.1 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 9.1 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 9.1 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 9.1 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 9.1 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 9.1 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 9.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.1 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 9.1 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 216 DLVRSLKAAKAEKQKLTKL 272 DL RSL A K EK KLT L Sbjct: 51 DLQRSLAAEKEEKMKLTVL 69 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 480 RHCWNSKPNTGCHRTRLEARIR-ACSNDYP 566 R CW K +T TRLE R R C+ +P Sbjct: 760 RMCWELKSSTIVMMTRLEERSRIKCTMYWP 789 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 371 EMRKVLVLVLRYLASSLVPW 312 +MRK+LVLV+ S+V W Sbjct: 129 KMRKLLVLVMATTVLSVVAW 148 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.4 bits (48), Expect = 6.9 Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 465 LTRLSRHCWNSKPNTGCHRTRL-EARIRACSND 560 +++L R CW+ PN R+ + ++ S+D Sbjct: 413 MSKLMRECWHMNPNVRLPALRIKKTLLKLASSD 445 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 371 EMRKVLVLVLRYLASSLVPW 312 +MRK+LVLV+ S+V W Sbjct: 129 KMRKLLVLVMATTVLSVVAW 148 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.4 bits (48), Expect = 6.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 453 KNRKLTRLSRHCWNS 497 KNRK R++RH W++ Sbjct: 203 KNRKSRRVTRHNWSA 217 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.4 bits (48), Expect = 6.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 453 KNRKLTRLSRHCWNS 497 KNRK R++RH W++ Sbjct: 204 KNRKSRRVTRHNWSA 218 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 9.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 489 WNSKPNTGCHR 521 WN PNTG +R Sbjct: 159 WNGSPNTGMYR 169 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 59 LSITTKYYETNIVPKSRHTPQ 79 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 59 LSITTKYYETNIVPKSRHTPQ 79 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 61 LSITTKYYETNIVPKSRHTPQ 81 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 61 LSITTKYYETNIVPKSRHTPQ 81 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 64 LSITTKYYETNIVPKSRHTPQ 84 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 64 LSITTKYYETNIVPKSRHTPQ 84 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQ 94 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 76 LSITTKYYETNIVPKSRHTPQ 96 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 76 LSITTKYYETNIVPKSRHTPQ 96 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 58 LSITTKYYETNIVPKSRHTPQ 78 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 58 LSITTKYYETNIVPKSRHTPQ 78 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 94 LQFTTKYTEVKHIFNTTHTPE 32 L TTKY E + + HTP+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQ 93 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -3 Query: 277 FDSFVNFCFSALAALRDLTRSPCFVIWSFKSDEAGVS 167 F +++ FC + L L I SF +D G+S Sbjct: 737 FHAYLGFCVDPSSLLSPLNHKRSSGIKSFNADFGGIS 773 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 248 GFSSFERSHQISLFCDLVVQI 186 G ++ +RSH +SLF + V+ I Sbjct: 1040 GINAGKRSHILSLFANYVIHI 1060 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,966 Number of Sequences: 2352 Number of extensions: 8325 Number of successful extensions: 76 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -