BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021843 (825 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary ... 25 2.1 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 24 4.9 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 24 6.5 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 8.6 >DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 99 Score = 25.4 bits (53), Expect = 2.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 379 DDASPPPDEWGPSSNFCMRCCTSISPGCSCV-VGVTRCEARP 257 +D + +E+ ++ C R CT+++ SC V V+ C RP Sbjct: 23 EDCTVENEEYYSCASPCRRNCTNLAQMLSCTGVCVSGCFCRP 64 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 328 MRCCTSISPGCSCVVGVTR 272 ++C TS PGC C G R Sbjct: 48 VKCQTSCLPGCVCKKGFVR 66 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 23.8 bits (49), Expect = 6.5 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = -2 Query: 554 IDTGPIWELFQQ*NSCKQIQGSTRSTFLRCYSFW 453 +D W ++++ + G R T+L+ + FW Sbjct: 25 LDPEEAWYVYERCHEDHLPSGPNRETYLKTWKFW 58 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 458 FWTCAQDGNSFRKDSSTPSSRATANY 381 F T A NSF+ + + ++ A ANY Sbjct: 591 FSTAAAVANSFKSEQFSSAAAAVANY 616 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,812 Number of Sequences: 2352 Number of extensions: 15478 Number of successful extensions: 34 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -