BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021843 (825 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.4 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 7.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 7.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/17 (47%), Positives = 11/17 (64%), Gaps = 2/17 (11%) Frame = -3 Query: 370 SPPPDEWGPSSN--FCM 326 SPPP++W P FC+ Sbjct: 415 SPPPEDWKPLDKCYFCL 431 Score = 21.8 bits (44), Expect = 7.9 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = -1 Query: 441 RWK*FQEGLFHPLFESHGQLRMMHHHL 361 RWK +Q+ L+ S HH L Sbjct: 45 RWKQYQDTLYSGTRSSESLTAQAHHRL 71 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 399 ESHGQLRMMHHHLQMNGV 346 + H L+ HHHLQ V Sbjct: 139 QRHHHLQNHHHHLQSTAV 156 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 7.9 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +3 Query: 192 WLGTTIQCSSSKSWCPDTNSTAGRASHRVTP 284 W + + CS P + +GR R TP Sbjct: 385 WQMSCVACSPPPRQTPPSRKESGRRRRRRTP 415 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 443 QDGNSFRKDSSTPSSR 396 +DGNS+R D SR Sbjct: 240 EDGNSYRNDGERSCSR 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,519 Number of Sequences: 438 Number of extensions: 4357 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -