BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021843 (825 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19110.1 68418.m02273 extracellular dermal glycoprotein-relat... 30 2.1 At5g37930.1 68418.m04569 seven in absentia (SINA) family protein... 28 6.5 >At5g19110.1 68418.m02273 extracellular dermal glycoprotein-related / EDGP-related similar to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741 Length = 405 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 544 APFGSCFNSKIVASRSRGVPEVPFLDVTASGRVRKME 434 APF CF+S+ P VP +++ GR+ +++ Sbjct: 296 APFKHCFDSRTAGKNLTAGPNVPVIEIGLPGRIGEVK 332 >At5g37930.1 68418.m04569 seven in absentia (SINA) family protein similar to SIAH1 protein [Brassica napus var. napus] GI:7657876; contains Pfam profile PF03145: Seven in absentia protein family Length = 349 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -3 Query: 331 CMRCCTSIS---PGCSCVVGVTRCEARPAVLLVS 239 C CCT + P C+ +G RC A V+ S Sbjct: 134 CTLCCTKVRNRCPSCTLPIGYVRCRAMEKVIEAS 167 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,831,696 Number of Sequences: 28952 Number of extensions: 323070 Number of successful extensions: 857 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -