BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021842 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_18221| Best HMM Match : HHH (HMM E-Value=0.65) 34 0.12 SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_48886| Best HMM Match : 4F5 (HMM E-Value=0.037) 33 0.22 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_22098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 SB_47590| Best HMM Match : TSP_3 (HMM E-Value=7.6e-09) 30 2.7 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_58585| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_30869| Best HMM Match : DUF164 (HMM E-Value=0.18) 29 4.7 SB_41444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_23547| Best HMM Match : NLPC_P60 (HMM E-Value=2.5) 28 8.2 SB_48346| Best HMM Match : PDZ (HMM E-Value=1.5e-33) 28 8.2 SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 28 8.2 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +3 Query: 252 SEYREKFATSPDTRRSKQADE-IEVKTEKIEESITKAASDVAQAIGGDVKQTEAELLSRV 428 S + +K PD + +K ADE + K E++ +++ +S +A GD++Q +EL ++V Sbjct: 869 SMFSQKVVVVPDRKMNKDADEGVSQKVEEMTGKMSELSSTTEKAT-GDIQQHISELSAKV 927 Query: 429 LGKINQTSTTLSDLLVGMKVDRTVEPEK 512 K + + + +K + EK Sbjct: 928 TRKSDSNTEKTVSYVSEVKTELKENTEK 955 >SB_18221| Best HMM Match : HHH (HMM E-Value=0.65) Length = 324 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 4/80 (5%) Frame = +3 Query: 243 NK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKA----ASDVAQAIGGDVKQTEA 410 NK S + T+P+ E + K EKI++ T + + +A+ + V + A Sbjct: 3 NKSSSKSKSITTAPEENEGANRHEEDEKREKIQKHTTNSVDLMTASIAELVSIGVTEELA 62 Query: 411 ELLSRVLGKINQTSTTLSDL 470 L++V GK+N S +S L Sbjct: 63 SRLTQVRGKLNTVSEVVSVL 82 >SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 33.9 bits (74), Expect = 0.17 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 3/110 (2%) Frame = +3 Query: 201 KDSRTVEKHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQA 380 KD +T ++ G SK K S EK P T+ SKQA E E KT+K T+A + Sbjct: 248 KDRQTEQRKSGPSKGKVSLKLEKNIL-PATQ-SKQARESEEKTQKKSGGDTQADEMITIT 305 Query: 381 IGGDVKQTEAELLSRVL---GKINQTSTTLSDLLVGMKVDRTVEPEKSNK 521 + + E + S K+ ++ +L V ++R V K++K Sbjct: 306 LRPQKSEKEVDASSERAPKDNKVRKSKIKTEELKVPKALEREVGHAKTSK 355 >SB_48886| Best HMM Match : 4F5 (HMM E-Value=0.037) Length = 476 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/82 (24%), Positives = 34/82 (41%) Frame = +1 Query: 52 SVTMLTRLKFRKDLRVIARCLSDKSKDNDGKPQVIQDAKKKTVKNDPATEKIQELLKSMM 231 +++ L RL + LRV K D DG + A + +E++K+M Sbjct: 356 AISQLQRLLDSQSLRVCRHVAGIKRVDKDGDHDTLASAASRNSYIPSLLHFHEEIMKAMN 415 Query: 232 APPKISEASTEKNSQHLQILGE 297 PP I +A ++ L + E Sbjct: 416 IPPTIPKAQEDRRDLMLNAIAE 437 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 32.3 bits (70), Expect = 0.50 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 9/102 (8%) Frame = +2 Query: 470 FSWDEGRQNSRT*EVQQKPDTREQ---QVKRLVSKAKTTEASPTRYSQRKSA-----YVP 625 F D+ R+ R+ + +K D R + + +R SK++ ++ S+R+S + Sbjct: 1576 FGLDDDRRRKRSSKSSKKRDRRSRSRSRERRRRSKSRDRDSRSRTSSRRRSRSSERRHRK 1635 Query: 626 NDRTRQGR-DSNRSGTPQITEIDIFGGEPLGIFKTTEPNYGT 748 +DR+R+ DS RSG+ +IDI G F+ + P T Sbjct: 1636 DDRSRESSYDSRRSGSIGTNKIDIIDNLNWGNFEDSFPLLAT 1677 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 222 KHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDV 371 KH KNK E ++ S +R+ + E+ +K EK+E+ + D+ Sbjct: 315 KHTEEEKNKAIERLKEATISEKGKRNNEITELNIKLEKLEKEFKELQEDL 364 >SB_22098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +3 Query: 231 GTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDV 395 G +K EY E F T K+A++ E+K EK E S T + A+ DV Sbjct: 316 GRNKVSFKEYAELFETVRTEADKKRAEKNEIKKEKAEASKTSVSPKSTAAMARDV 370 >SB_47590| Best HMM Match : TSP_3 (HMM E-Value=7.6e-09) Length = 669 Score = 29.9 bits (64), Expect = 2.7 Identities = 25/94 (26%), Positives = 42/94 (44%) Frame = +3 Query: 261 REKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDVKQTEAELLSRVLGKI 440 R+K DT+R K +D + K +K+ S+ KA + Q+I D Q+ E ++ + + Sbjct: 484 RDKVRDLADTKRDKVSDLADTKHDKVISSVEKALN---QSISLDYGQSNKEKATKAVDRA 540 Query: 441 NQTSTTLSDLLVGMKVDRTVEPEKSNKNRILESS 542 Q+ G K KSN N+ + S Sbjct: 541 -QSIFKCCGATQGPKDWANTAWAKSNTNQTVPES 573 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 29.5 bits (63), Expect = 3.6 Identities = 24/71 (33%), Positives = 32/71 (45%) Frame = +3 Query: 201 KDSRTVEKHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQA 380 K+S VE G + E E T P+ ADE + KIEE+ + A A+A Sbjct: 503 KESEEVEAETGQVE----EQAEMIETEPEVVEV-HADEEKADKAKIEEAKSDEAEAQAEA 557 Query: 381 IGGDVKQTEAE 413 I V + EAE Sbjct: 558 IEAKVDKVEAE 568 >SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1401 Score = 29.5 bits (63), Expect = 3.6 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 9/98 (9%) Frame = +3 Query: 207 SRTVEKHDGTSKNK*SEY-REKFATSPDTRRSK-QADEIEVKTEKIEESITKAAS--DVA 374 +R ++ D T N ++ RE+ A++ R + + D + K +K E + A+ D+A Sbjct: 535 ARAQDRLDKTLDNAETQLDRERSASAARIRGLEDELDRMAEKLQKANERAYQQAANGDLA 594 Query: 375 QAIGGDVKQTE-----AELLSRVLGKINQTSTTLSDLL 473 + +G +V + A LLS LGK +Q + L LL Sbjct: 595 RQLGNEVAALQDEVHRARLLSHKLGKADQDNAALEALL 632 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = +2 Query: 512 VQQKPDTREQQVKRLVSKAKTTEASPT---RYSQRKSAYVPNDRTRQGRDSNRSGTPQI 679 V KP T++ + ++ K T+ +P S + P D + SN+ TPQ+ Sbjct: 563 VSAKPPTKKTTPQSMIPPGKPTDQTPKPPGSTSPNSATQGPTDNLMSAKPSNKKPTPQV 621 >SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 29.1 bits (62), Expect = 4.7 Identities = 33/138 (23%), Positives = 52/138 (37%) Frame = +3 Query: 45 RIVSYYVNKTQVQKRFKGNRTVFVRQIQG**WEASSNSRCQEENRKK*SGY*KDSRTVEK 224 R++ Y+ +V KG V + +G +A + ++ QEE +K K + Sbjct: 289 RLLDEYIGMLKVLLN-KGMTAVAEAEQKGIKEKAETEAKKQEEEERKRDEEKKKAERAAA 347 Query: 225 HDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDVKQT 404 K K E K+ +E EK E+ I AS + D+K+ Sbjct: 348 EARKKKEKAKSVPEYLVDCTSDTAFKEYTRLEKLLEKTEKEIEPLASSKEK----DMKKL 403 Query: 405 EAELLSRVLGKINQTSTT 458 + EL V IN S T Sbjct: 404 KLELQKAVTTPINTISDT 421 >SB_58585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +3 Query: 234 TSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDV-AQAIGGDVKQTEA 410 +SK+K R+K + + + E++VKT+K+ E+++K+ V Q I ++K+T Sbjct: 17 SSKDKDIILRQKTEELDEAMQEMKRLEMQVKTQKVSETLSKSGCFVEQQEILNNMKKTGD 76 Query: 411 EL 416 +L Sbjct: 77 DL 78 >SB_30869| Best HMM Match : DUF164 (HMM E-Value=0.18) Length = 442 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/75 (21%), Positives = 34/75 (45%) Frame = +1 Query: 67 TRLKFRKDLRVIARCLSDKSKDNDGKPQVIQDAKKKTVKNDPATEKIQELLKSMMAPPKI 246 TR++F+ +L + + +KD + Q + KK+ + E++Q+ + KI Sbjct: 213 TRIQFQDELNTLKYTVDRTAKDLEATRQKYNELKKEVLTRAERLERVQQERADLQDQLKI 272 Query: 247 SEASTEKNSQHLQIL 291 + + Q Q+L Sbjct: 273 ATDESLSAEQRAQML 287 >SB_41444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 690 IYLVVSHLVYSRQQNQTMEQNWMFGEPKETRAKF 791 +Y++++ L ++N ME N +P+ETR+ F Sbjct: 149 MYIIITPLFMRARKNNAMEYNQKPRDPRETRSDF 182 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 4/62 (6%) Frame = +3 Query: 210 RTVEKHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVK----TEKIEESITKAASDVAQ 377 R VE SK + REK R K+ +E + K TEK+EES+ K V + Sbjct: 10 RKVEWKGSYSKRTTRKVREKREEGDTRREEKRGEERKKKEKAETEKVEESVRKGKFGVVK 69 Query: 378 AI 383 + Sbjct: 70 KV 71 >SB_23547| Best HMM Match : NLPC_P60 (HMM E-Value=2.5) Length = 232 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 100 IARCLSDK-SKDNDGKPQVIQDAKKKTVKND--PATEKIQELLKSMMAPPKISE 252 + S+K SK+N G PQ+IQD + + D P I+ +++ P ++++ Sbjct: 174 VPEATSEKVSKENQGNPQLIQDPIESNLPVDQPPEPPSIRTSVRARQPPARLND 227 >SB_48346| Best HMM Match : PDZ (HMM E-Value=1.5e-33) Length = 708 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 626 NDRTRQGRDSNRSGTPQITEIDIFGGEPLGIFKTTEPNYGTKLD 757 +++T + S+R+ T +GG + FK PN+G KLD Sbjct: 16 SEQTDGRQISSRTSNSTTTTKSKYGGTMVFEFKNCSPNFGIKLD 59 >SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +2 Query: 527 DTREQQVKRLVSKAKTTEASPTRYSQRKSAYVPNDRTRQGRDSNRSGTPQITEIDIFGGE 706 + E++ K V +T E P R ++R + N + +Q ++ + T E+ IFGG Sbjct: 704 EKEEEKYKPKVIPEQTRE--PLRENKRADSREINLQIQQQHEAISALTLPQPEVQIFGGN 761 Query: 707 PLGIFK 724 PL +K Sbjct: 762 PLEYYK 767 >SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 830 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = +1 Query: 67 TRLKFRKDLRVIARCLSDKSKDNDGKPQVIQDAKKKTVKNDPATEKIQELLKSMMAPPKI 246 +R F+ D + +++ S+ + KP+ + KKK K +P QE S+ K Sbjct: 665 SRPAFKPDKQSVSQSKCKDSRPVESKPKENRPEKKKATKPNPKPSSSQESNWSLEDLTKF 724 Query: 247 SEAS 258 +EA+ Sbjct: 725 TEAA 728 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,594,220 Number of Sequences: 59808 Number of extensions: 448263 Number of successful extensions: 1548 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1529 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -