BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021842 (841 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19160.3 68417.m02827 expressed protein 34 0.14 At4g19160.2 68417.m02826 expressed protein 34 0.14 At4g19160.1 68417.m02828 expressed protein 34 0.14 At1g77300.1 68414.m09002 SET domain-containing protein similar t... 33 0.24 At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransfera... 32 0.55 At5g57130.1 68418.m07135 expressed protein 31 0.72 At5g47430.1 68418.m05844 expressed protein 31 0.72 At2g23480.1 68415.m02803 hypothetical protein contains Pfam prof... 31 0.95 At5g11710.1 68418.m01368 epsin N-terminal homology (ENTH) domain... 30 2.2 At5g63550.1 68418.m07976 expressed protein 29 2.9 At5g22760.1 68418.m02658 PHD finger family protein contains Pfam... 29 2.9 At2g19410.1 68415.m02264 protein kinase family protein contains ... 29 2.9 At5g55600.1 68418.m06932 agenet domain-containing protein / brom... 29 3.8 At4g03210.1 68417.m00440 xyloglucan:xyloglucosyl transferase, pu... 29 3.8 At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai... 29 5.1 At5g02950.1 68418.m00238 PWWP domain-containing protein predicte... 29 5.1 At1g56510.1 68414.m06498 disease resistance protein (TIR-NBS-LRR... 29 5.1 At1g21810.1 68414.m02729 expressed protein 29 5.1 At4g29940.1 68417.m04259 pathogenesis-related homeodomain protei... 28 6.7 At3g51250.1 68416.m05610 senescence/dehydration-associated prote... 28 6.7 At3g14230.3 68416.m01802 AP2 domain-containing protein RAP2.2 (R... 28 6.7 At3g14230.2 68416.m01801 AP2 domain-containing protein RAP2.2 (R... 28 6.7 At3g14230.1 68416.m01800 AP2 domain-containing protein RAP2.2 (R... 28 6.7 At1g21670.1 68414.m02712 expressed protein similar to TolB prote... 28 6.7 At5g06930.1 68418.m00783 expressed protein 28 8.9 At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiqui... 28 8.9 At3g59410.1 68416.m06626 protein kinase family protein low simil... 28 8.9 >At4g19160.3 68417.m02827 expressed protein Length = 454 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Frame = +3 Query: 303 QADEIEVKTEKIEESITKAASDVAQAIGGDVKQTEAELLSRVLG-----KINQTSTTLSD 467 Q+D E +E++ + K+ S+ I K+ EAEL+SR +G + +T L D Sbjct: 151 QSDPSETDSEELLQLDGKSISEWVSEIDAISKEVEAELVSRDIGCHLVQVLEAVNTVLFD 210 Query: 468 LLVGMKVDRTVEPEKSNKNRIL 533 L + T++PE S + +L Sbjct: 211 LRGFKRTSITLDPENSYLHSVL 232 >At4g19160.2 68417.m02826 expressed protein Length = 453 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Frame = +3 Query: 303 QADEIEVKTEKIEESITKAASDVAQAIGGDVKQTEAELLSRVLG-----KINQTSTTLSD 467 Q+D E +E++ + K+ S+ I K+ EAEL+SR +G + +T L D Sbjct: 151 QSDPSETDSEELLQLDGKSISEWVSEIDAISKEVEAELVSRDIGCHLVQVLEAVNTVLFD 210 Query: 468 LLVGMKVDRTVEPEKSNKNRIL 533 L + T++PE S + +L Sbjct: 211 LRGFKRTSITLDPENSYLHSVL 232 >At4g19160.1 68417.m02828 expressed protein Length = 312 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Frame = +3 Query: 303 QADEIEVKTEKIEESITKAASDVAQAIGGDVKQTEAELLSRVLG-----KINQTSTTLSD 467 Q+D E +E++ + K+ S+ I K+ EAEL+SR +G + +T L D Sbjct: 10 QSDPSETDSEELLQLDGKSISEWVSEIDAISKEVEAELVSRDIGCHLVQVLEAVNTVLFD 69 Query: 468 LLVGMKVDRTVEPEKSNKNRIL 533 L + T++PE S + +L Sbjct: 70 LRGFKRTSITLDPENSYLHSVL 91 >At1g77300.1 68414.m09002 SET domain-containing protein similar to huntingtin interacting protein 1 [Homo sapiens] GI:12697196; contains Pfam profile PF00856: SET domain Length = 1759 Score = 33.1 bits (72), Expect = 0.24 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 2/103 (1%) Frame = +3 Query: 222 KHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDVKQ 401 KH + N + + KF+ S R ++ E + + + S+ + SD + + + Sbjct: 761 KHPKSKSNGTKKGKSKFSESAKDGRKNESHEGVEQRKSLNTSMGRDDSDYPEVGRIESHK 820 Query: 402 TEAELLSRVLGKINQTSTTL-SDLLVG-MKVDRTVEPEKSNKN 524 T LL +GK + T T+ SD+ G M VD T+E S ++ Sbjct: 821 TTGALLDADIGKTSATYGTISSDVTHGEMVVDVTIEDSYSTES 863 >At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransferase, putative similar to Swiss-Prot:P05055 polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) (Polynucleotide phosphorylase) (PNPase) [Escherichia coli] Length = 991 Score = 31.9 bits (69), Expect = 0.55 Identities = 25/90 (27%), Positives = 45/90 (50%) Frame = +3 Query: 273 ATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDVKQTEAELLSRVLGKINQTS 452 ATS R+ K + T+K EE++ A + A G++ + + +L S V K N T+ Sbjct: 830 ATSKPDRKPKSTASKLIATQKEEEALESIAPEETSAECGEILKQDGKLKS-VSPKNNSTA 888 Query: 453 TTLSDLLVGMKVDRTVEPEKSNKNRILESS 542 S+L+ K ++ E ++N+ ES+ Sbjct: 889 ---SNLVSFSKAKKSTMKENLSENKAEESA 915 >At5g57130.1 68418.m07135 expressed protein Length = 920 Score = 31.5 bits (68), Expect = 0.72 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +3 Query: 267 KFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAI--GGDVKQTEAELLSRVLGKI 440 KF SP + + +++E+ +++ + + + AI GD+K T E+ + G I Sbjct: 229 KFHFSPMASKFMRREDVELNIKELRKKVLSLTTSGKNAIIFTGDLKWTVKEITNNNSGGI 288 Query: 441 NQTSTTLSDL 470 N+ S++ S L Sbjct: 289 NEISSSYSPL 298 >At5g47430.1 68418.m05844 expressed protein Length = 879 Score = 31.5 bits (68), Expect = 0.72 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +2 Query: 527 DTREQQVKRLVSKAKTTEA--SPTRYSQRKSAYVPNDRTRQGRDSNRS 664 D R + KRL + T SP+R S+RKS P++R RQ RD RS Sbjct: 664 DRRRRPEKRLSPEHPPTRKNISPSRDSKRKSERYPDERDRQ-RDRERS 710 >At2g23480.1 68415.m02803 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 705 Score = 31.1 bits (67), Expect = 0.95 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 267 KFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDVKQTEAE 413 K + +T+ + Q DE+E + EK E S + + +Q +G D E E Sbjct: 121 KHIPAEETQENMQTDEVEDENEKEEGSEKEESGSSSQTLGSDSDSEETE 169 >At5g11710.1 68418.m01368 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua]; similar to clathrin assembly protein AP180 (GI:6492344) [Xenopus laevis]; Af10-protein, Avena fatua, EMBL:U80041 Length = 560 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 626 NDRTRQGRDSNRSGTPQITEIDIFGGEPLGIFKTTEP 736 +D +G SN+ T ++D+FGG+ +G F + P Sbjct: 268 DDFDPRGTSSNKPSTGSANQVDLFGGDLIGDFLDSGP 304 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 29.5 bits (63), Expect = 2.9 Identities = 25/101 (24%), Positives = 49/101 (48%), Gaps = 10/101 (9%) Frame = +3 Query: 201 KDSRTVEKHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQA 380 KD + K S K S+ K +SP + ++ D +E EK ++ +K + ++ Sbjct: 356 KDKQPSAKGSARSGEKSSKQIAKSTSSP--AKKQKVDHVESSKEKSKKQPSKPQAKGSKE 413 Query: 381 IGGDVKQTEA----------ELLSRVLGKINQTSTTLSDLL 473 G K+ +A E++S++L +++ + TLSD+L Sbjct: 414 KGKATKKGKAKAEPTRKEMLEVVSKILKEVDFNTATLSDIL 454 >At5g22760.1 68418.m02658 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1566 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 763 PNIQFCSIVWFCCLEYTKWLTTKYINFCDLW 671 PN+Q + W C L Y LT + CD+W Sbjct: 1239 PNLQ--PVCWICKLPYNPGLTYIHCTSCDMW 1267 >At2g19410.1 68415.m02264 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 801 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +3 Query: 210 RTVEKHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQA 380 +T K +N SE+R+ + P+T R + EIE + E+++ + QA Sbjct: 276 KTCTKPQSNVENIVSEHRDSDRSPPETSRKSKKVEIEEEVERLKNELQSTVFKYKQA 332 >At5g55600.1 68418.m06932 agenet domain-containing protein / bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain and PF05641: Agenet domain Length = 663 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 4/78 (5%) Frame = +1 Query: 82 RKDLRVIARCLSDKSKDNDGKPQVI----QDAKKKTVKNDPATEKIQELLKSMMAPPKIS 249 RKD+R+ + D D D KP+++ D+ ++ + +T K P + Sbjct: 513 RKDIRISRDWVGDSWVDIDPKPEILAIVSSDSSSESKLSMLSTLSKDTKAKPSAMPNIVE 572 Query: 250 EASTEKNSQHLQILGEVN 303 EA E + +LGE N Sbjct: 573 EAEPEGEKAYNSLLGEQN 590 >At4g03210.1 68417.m00440 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative contains similarity to xyloglucan endo-transglycosylase-like protein (XET-1) GI:5070246 from [Medicago truncatula] Length = 290 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +3 Query: 645 EETVTEVVLHKSQKLIYLVVSHLVY 719 E TV+E+ LH++ +LI++ +H++Y Sbjct: 244 EPTVSELSLHQNHQLIWVRANHMIY 268 >At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains Pfam profiles PF00270:DEAD/DEAH box helicase and PF00271: Helicase conserved C-terminal domain; identical to cDNA RH27 helicase, partial GI:4033334 Length = 633 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +3 Query: 312 EIEVKTEKIEESITKAASD-VAQAIGGDVKQTEAELLSRVLGKINQTSTTLSDLL 473 E+ +++ + + + K S V + IGG+ ++TEAE+L++ + + T L D L Sbjct: 237 ELAIQSYGVAKELLKYHSQTVGKVIGGEKRKTEAEILAKGVNLLVATPGRLLDHL 291 >At5g02950.1 68418.m00238 PWWP domain-containing protein predicted protein, Arabidopsis thaliana Length = 632 Score = 28.7 bits (61), Expect = 5.1 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +1 Query: 67 TRLKFRKDLRVIARCLSDKSKDNDGKPQVIQDAKKKTVKNDPATEKIQELLKSMMAPPKI 246 T+ K DL V RC S ++ DGK KK+ V++ + + + + KS + Sbjct: 321 TKEKTLSDLTVKKRCGSRSTEKLDGKS---HSEKKRKVESSESGKSEKRIKKSQQKEDSV 377 Query: 247 SEASTEKN 270 S+ S E++ Sbjct: 378 SKHSNEES 385 >At1g56510.1 68414.m06498 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1007 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 718 IQDNRT-KLWNKTGCLENLKKRELS 789 +QD+ KLW T CL NLKK +LS Sbjct: 608 MQDSELQKLWEGTQCLANLKKIDLS 632 >At1g21810.1 68414.m02729 expressed protein Length = 628 Score = 28.7 bits (61), Expect = 5.1 Identities = 21/72 (29%), Positives = 35/72 (48%) Frame = +3 Query: 261 REKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDVKQTEAELLSRVLGKI 440 +EK T + R + ++ +K EK+E I + D+A A G K + + LGK Sbjct: 469 KEKCETFEEELRREIEEKTMIKREKVEPKIKQ--EDIATAAG---KFADCQKTIASLGKQ 523 Query: 441 NQTSTTLSDLLV 476 Q+ TL + L+ Sbjct: 524 LQSLATLEEFLI 535 >At4g29940.1 68417.m04259 pathogenesis-related homeodomain protein (PRHA) identical to Pathogenesis-related homeodomain protein (PRHA) (SP:P48785) [Arabidopsis thaliana) Length = 796 Score = 28.3 bits (60), Expect = 6.7 Identities = 24/110 (21%), Positives = 51/110 (46%), Gaps = 3/110 (2%) Frame = +3 Query: 216 VEKHDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAASDVAQAIGGDV 395 VE+++ SK + E S + A+E E +++ IEE + + +++ + Sbjct: 619 VEENETESKMMKEPHEE---LSSEMSLKTAAEEKETESKMIEEPHEELSREMSLKTAVEE 675 Query: 396 KQTEAELLSRVLGKIN---QTSTTLSDLLVGMKVDRTVEPEKSNKNRILE 536 K+TE++++ ++N ST + + G K+ E SN+ + E Sbjct: 676 KETESKMMEEPHDELNSEMSLSTAVEEKETGSKMTEESHEELSNEMSLEE 725 >At3g51250.1 68416.m05610 senescence/dehydration-associated protein-related similar to senescence-associated protein 12 [Hemerocallis hybrid cultivar] gi|3551958|gb|AAC34857; similar to early-responsive to dehydration stress ERD7 protein [Arabidopsis thaliana] gi|15320412|dbj|BAB63916 Length = 463 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +3 Query: 216 VEKHDGTSKNK*SEYREKFATSPDT-RRSKQADEIEVKTEKIEESITKAASDVAQAIGGD 392 ++K + KN+ S ++ SP+T RR K+ + TEK+ + V+ I G Sbjct: 291 LKKGNEVMKNRLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGS 350 Query: 393 VKQTEA 410 + ++A Sbjct: 351 MANSKA 356 >At3g14230.3 68416.m01802 AP2 domain-containing protein RAP2.2 (RAP2.2) identical to AP2 domain containing protein RAP2.2 GI:2281629 from [Arabidopsis thaliana] Length = 374 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 505 GSTVLSTFIPTKRSLRVVEV*LIFPSTRDRSSAS 404 G ++S FIP RSLRV I+P +++ AS Sbjct: 3 GGAIISDFIPPPRSLRVTNE-FIWPDLKNKVKAS 35 >At3g14230.2 68416.m01801 AP2 domain-containing protein RAP2.2 (RAP2.2) identical to AP2 domain containing protein RAP2.2 GI:2281629 from [Arabidopsis thaliana] Length = 375 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 505 GSTVLSTFIPTKRSLRVVEV*LIFPSTRDRSSAS 404 G ++S FIP RSLRV I+P +++ AS Sbjct: 3 GGAIISDFIPPPRSLRVTNE-FIWPDLKNKVKAS 35 >At3g14230.1 68416.m01800 AP2 domain-containing protein RAP2.2 (RAP2.2) identical to AP2 domain containing protein RAP2.2 GI:2281629 from [Arabidopsis thaliana] Length = 379 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 505 GSTVLSTFIPTKRSLRVVEV*LIFPSTRDRSSAS 404 G ++S FIP RSLRV I+P +++ AS Sbjct: 3 GGAIISDFIPPPRSLRVTNE-FIWPDLKNKVKAS 35 >At1g21670.1 68414.m02712 expressed protein similar to TolB protein precursor (SP:P50601) {Pseudomonas aeruginosa} Length = 703 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 653 SNRSGTPQITEIDIFGGEPLGIFKTTEPNYGTKLDVW 763 S RSGT + +D GE G+F+ T N+ + W Sbjct: 508 SARSGTKNLYIMDAEKGESGGLFRLTNGNWNDTIATW 544 >At5g06930.1 68418.m00783 expressed protein Length = 657 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = +3 Query: 225 HDGTSKNK*SEYREKFATSPDTRRSKQADEIEVKTEKIEESITKAAS 365 H+ S N+ Y+EK + + +++ + +E + EK+EE + + A+ Sbjct: 166 HNNESDNETLVYKEKKRSDVEKVLAQKIETMEARIEKLEEELREVAA 212 >At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiquitin-transferase family protein / armadillo/beta-catenin-like repeat-containing protein similar to SP|Q14669 Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profiles PF00632: HECT-domain (ubiquitin-transferase), PF00514: Armadillo/beta-catenin-like repeat Length = 1502 Score = 27.9 bits (59), Expect = 8.9 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 473 SWDEGRQNSRT*EVQQKPDTREQQVKRLVS--KAKTTEASPTRYSQRKSAYVPNDRTRQG 646 S D G+QN + ++ QKP T+E VK L + + +S T ++ S YV R ++G Sbjct: 540 SSDRGQQNQGSADLSQKPVTKE-IVKCLCQSFERSLSSSSQTCKIEKDSVYVLATRIKEG 598 >At3g59410.1 68416.m06626 protein kinase family protein low similarity to GCN2 eIF2alpha kinase [Mus musculus] GI:6066585; contains Pfam profiles PF03129: Anticodon binding domain, PF00069: Protein kinase domain Length = 1241 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -1 Query: 265 SLYSLHLFLEVPSCFSTVLESFQ*PDHFLRFSSWHL--ELLEASHH 134 +L S +L++++ C T+ + F+ +HF + +WHL +++E H Sbjct: 531 NLESTYLYIQMEYCPRTLRQVFESYNHFDKDFAWHLIRQIVEGLAH 576 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,024,077 Number of Sequences: 28952 Number of extensions: 338070 Number of successful extensions: 1209 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1208 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1941125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -