BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021841 (810 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 25 3.7 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 6.4 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 24.6 bits (51), Expect = 3.7 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -3 Query: 691 NASITRSGVLEVCKD--ILIIPTAPLYSVCFRLIPNLELT 578 N ++ R G ++ +D L+ +YSV F+LIP + LT Sbjct: 226 NVTLYRLGTSQLVRDNPALLNVNFWIYSVVFKLIPCIALT 265 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.8 bits (49), Expect = 6.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 164 DRTQKYLKECERACVKTEETSESEKRNQEI 253 +RT+K LKE C +T ET + KR + + Sbjct: 148 ERTEKSLKEALEGCSQT-ETPVNGKRGRNL 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 815,605 Number of Sequences: 2352 Number of extensions: 16396 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -