BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021841 (810 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L48513-1|AAC41995.1| 354|Homo sapiens paraoxonase 2 protein. 31 6.5 BC040010-1|AAH40010.1| 354|Homo sapiens paraoxonase 2 protein. 31 6.5 AY210982-1|AAO18083.1| 354|Homo sapiens paraoxonase 2 protein. 31 6.5 AF001601-1|AAC27944.1| 354|Homo sapiens paraoxonase protein. 31 6.5 AC005021-1|AAC62431.1| 354|Homo sapiens unknown protein. 31 6.5 >L48513-1|AAC41995.1| 354|Homo sapiens paraoxonase 2 protein. Length = 354 Score = 30.7 bits (66), Expect = 6.5 Identities = 15/64 (23%), Positives = 32/64 (50%) Frame = +1 Query: 289 KNLSLSKIRADHYSDFIDDDLKLYIGSVNYPEIRIDLELFNTIKTTFEKILLESIEKGVM 468 + L+ S FID+D +Y+ VN+PE + +E+F + + L++++ ++ Sbjct: 104 RGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELL 163 Query: 469 EITN 480 N Sbjct: 164 PSVN 167 >BC040010-1|AAH40010.1| 354|Homo sapiens paraoxonase 2 protein. Length = 354 Score = 30.7 bits (66), Expect = 6.5 Identities = 15/64 (23%), Positives = 32/64 (50%) Frame = +1 Query: 289 KNLSLSKIRADHYSDFIDDDLKLYIGSVNYPEIRIDLELFNTIKTTFEKILLESIEKGVM 468 + L+ S FID+D +Y+ VN+PE + +E+F + + L++++ ++ Sbjct: 104 RGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELL 163 Query: 469 EITN 480 N Sbjct: 164 PSVN 167 >AY210982-1|AAO18083.1| 354|Homo sapiens paraoxonase 2 protein. Length = 354 Score = 30.7 bits (66), Expect = 6.5 Identities = 15/64 (23%), Positives = 32/64 (50%) Frame = +1 Query: 289 KNLSLSKIRADHYSDFIDDDLKLYIGSVNYPEIRIDLELFNTIKTTFEKILLESIEKGVM 468 + L+ S FID+D +Y+ VN+PE + +E+F + + L++++ ++ Sbjct: 104 RGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELL 163 Query: 469 EITN 480 N Sbjct: 164 PSVN 167 >AF001601-1|AAC27944.1| 354|Homo sapiens paraoxonase protein. Length = 354 Score = 30.7 bits (66), Expect = 6.5 Identities = 15/64 (23%), Positives = 32/64 (50%) Frame = +1 Query: 289 KNLSLSKIRADHYSDFIDDDLKLYIGSVNYPEIRIDLELFNTIKTTFEKILLESIEKGVM 468 + L+ S FID+D +Y+ VN+PE + +E+F + + L++++ ++ Sbjct: 104 RGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELL 163 Query: 469 EITN 480 N Sbjct: 164 PSVN 167 >AC005021-1|AAC62431.1| 354|Homo sapiens unknown protein. Length = 354 Score = 30.7 bits (66), Expect = 6.5 Identities = 15/64 (23%), Positives = 32/64 (50%) Frame = +1 Query: 289 KNLSLSKIRADHYSDFIDDDLKLYIGSVNYPEIRIDLELFNTIKTTFEKILLESIEKGVM 468 + L+ S FID+D +Y+ VN+PE + +E+F + + L++++ ++ Sbjct: 104 RGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELL 163 Query: 469 EITN 480 N Sbjct: 164 PSVN 167 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,897,418 Number of Sequences: 237096 Number of extensions: 2325018 Number of successful extensions: 4428 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4428 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10036353240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -