BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021839 (831 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 97 6e-22 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 97 6e-22 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 97 6e-22 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 97 8e-22 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 97.1 bits (231), Expect = 6e-22 Identities = 47/108 (43%), Positives = 71/108 (65%), Gaps = 2/108 (1%) Frame = +2 Query: 254 RSILQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEE 433 + +++AH+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVNV Q Sbjct: 86 KGMVKAHQAILSACSPYFEQIFVENKHPHPIIYLRDVEVNEMRALLDFMYQGEVNVGQHN 145 Query: 434 LASFISTAEQLQVKGLTGNQNEESSRHPNQSRLRGQ--APGRHNKDNL 571 L +F+ TAE L+V+GLT + + S S+LR + R +D+L Sbjct: 146 LQNFLKTAESLKVRGLTESSADRYSA-DTDSKLRSERIRDSRDERDSL 192 Score = 34.7 bits (76), Expect = 0.003 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 148 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEE 258 D+Q+ L WNN +N++ LL L DVTLA E+ Sbjct: 50 DQQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACEK 86 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 97.1 bits (231), Expect = 6e-22 Identities = 47/108 (43%), Positives = 71/108 (65%), Gaps = 2/108 (1%) Frame = +2 Query: 254 RSILQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEE 433 + +++AH+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVNV Q Sbjct: 86 KGMVKAHQAILSACSPYFEQIFVENKHPHPIIYLRDVEVNEMRALLDFMYQGEVNVGQHN 145 Query: 434 LASFISTAEQLQVKGLTGNQNEESSRHPNQSRLRGQ--APGRHNKDNL 571 L +F+ TAE L+V+GLT + + S S+LR + R +D+L Sbjct: 146 LQNFLKTAESLKVRGLTESSADRYSA-DTDSKLRSERIRDSRDERDSL 192 Score = 34.7 bits (76), Expect = 0.003 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 148 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEE 258 D+Q+ L WNN +N++ LL L DVTLA E+ Sbjct: 50 DQQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACEK 86 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 97.1 bits (231), Expect = 6e-22 Identities = 47/108 (43%), Positives = 71/108 (65%), Gaps = 2/108 (1%) Frame = +2 Query: 254 RSILQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEE 433 + +++AH+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVNV Q Sbjct: 38 KGMVKAHQAILSACSPYFEQIFVENKHPHPIIYLRDVEVNEMRALLDFMYQGEVNVGQHN 97 Query: 434 LASFISTAEQLQVKGLTGNQNEESSRHPNQSRLRGQ--APGRHNKDNL 571 L +F+ TAE L+V+GLT + + S S+LR + R +D+L Sbjct: 98 LQNFLKTAESLKVRGLTESSADRYSA-DTDSKLRSERIRDSRDERDSL 144 Score = 33.9 bits (74), Expect = 0.006 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 148 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEE 258 D+Q+ L WNN N++ LL L DVTLA E+ Sbjct: 2 DQQYCLRWNNHQPNLTTVLTTLLQDEKLCDVTLACEK 38 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 96.7 bits (230), Expect = 8e-22 Identities = 47/108 (43%), Positives = 71/108 (65%), Gaps = 2/108 (1%) Frame = +2 Query: 254 RSILQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEE 433 + +++AH+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVNV Q Sbjct: 86 KGMVKAHQAILSACSPYFEQIFVENKHLHPIIYLRDVEVNEMRALLDFMYQGEVNVGQHN 145 Query: 434 LASFISTAEQLQVKGLTGNQNEESSRHPNQSRLRGQ--APGRHNKDNL 571 L +F+ TAE L+V+GLT + + S S+LR + R +D+L Sbjct: 146 LQNFLKTAESLKVRGLTESSADRYSA-DTDSKLRSERIRDSRDERDSL 192 Score = 34.7 bits (76), Expect = 0.003 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 148 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEE 258 D+Q+ L WNN +N++ LL L DVTLA E+ Sbjct: 50 DQQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACEK 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 827,730 Number of Sequences: 2352 Number of extensions: 16080 Number of successful extensions: 34 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -