BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021836 (802 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 57 2e-10 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 56.8 bits (131), Expect = 2e-10 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = +2 Query: 335 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 511 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G++L+A Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMA 238 Score = 42.3 bits (95), Expect = 5e-06 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 4/93 (4%) Frame = +1 Query: 496 KEFSCVAQTGSGKTLAYILPAIVHINNQPP----IRRGDGPIALVLAPTRELAQQIQQVA 663 ++ AQTGSGKT A+ +P I + + P ++++PTREL QI Q Sbjct: 234 RDLMACAQTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQI 293 Query: 664 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEI 762 F S ++ +GG Q L G I Sbjct: 294 VKFSLNSILKTVVAYGGTSVMHQRGKLSAGCHI 326 Score = 28.7 bits (61), Expect = 0.066 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 741 LGEGSRNIIATPGRLIDFLE 800 L G ++ATPGRL+DF+E Sbjct: 320 LSAGCHILVATPGRLLDFVE 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,831 Number of Sequences: 438 Number of extensions: 4493 Number of successful extensions: 12 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -