BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021832 (842 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 4.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.2 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.6 bits (46), Expect = 4.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 134 DIHTPDELAGLTPEQADQLRAEWSRELARVEDEIATLRT 250 DI+T +ELA T +++ +S AR+ +I + T Sbjct: 246 DIYTREELAQRTKLTEARIQVWFSNRRARLRKQITSAAT 284 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 370 YQKTESVIKTTAEKTSSIIGGITAG 444 + KTE + T +KT+S+ + G Sbjct: 316 HNKTEIFLNITGDKTNSVFEHVKLG 340 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,890 Number of Sequences: 336 Number of extensions: 3620 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23244256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -