BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021832 (842 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g59453.1 68414.m06679 transcription factor-related weak simil... 31 0.96 At1g18620.1 68414.m02321 expressed protein 30 2.2 At4g26050.1 68417.m03750 leucine-rich repeat family protein cont... 29 3.9 At2g35110.1 68415.m04307 HEM protein-related weak similarity to ... 29 3.9 At1g78270.1 68414.m09121 UDP-glucose glucosyltransferase, putati... 29 3.9 At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 29 3.9 At4g10270.1 68417.m01688 wound-responsive family protein similar... 29 5.1 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 28 6.8 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 31.1 bits (67), Expect = 0.96 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = +1 Query: 313 KEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSSIIGGITAGVSSKLGQMRNSESFR 489 K ++D N+ ++N S +K S++KT E SII ++S NSESF+ Sbjct: 907 KSNSKDKNKAVENSPSSSKKRKRASLVKTKGEGVKSIIVDGQKVLNSDAIDASNSESFQ 965 >At1g18620.1 68414.m02321 expressed protein Length = 978 Score = 29.9 bits (64), Expect = 2.2 Identities = 21/78 (26%), Positives = 31/78 (39%) Frame = +2 Query: 566 LRRGAA*RQWRHLAPHPRAQAAALSGTLSCHSTRHMSFAISPLPYRARPREAGNSTHTKR 745 LR + R R PR+ + + S R F + PL P E T+R Sbjct: 314 LRENSLNRSLRFSPSSPRSLGKDPAASSSSPRWRSSEFVMKPLSSLRYPIEPAPWKQTER 373 Query: 746 NTFGLKSRYQAIKSKKKS 799 N F K +++KS +S Sbjct: 374 NRFSQKQACRSVKSLSQS 391 >At4g26050.1 68417.m03750 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeat domains; Length = 383 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 325 EDVNQGLKNVKESQVYQKTESVIKTTAEKTSSIIGGITA-GVSSKLGQMRNSE 480 E V QGL+ +K+ + TES KT +K S IG + G+SS G+ E Sbjct: 286 EVVEQGLEALKQYMSEKMTESYKKTPTKKKSWGIGKLVKYGLSSSPGRSTGRE 338 >At2g35110.1 68415.m04307 HEM protein-related weak similarity to Membrane-associated protein Hem (Dhem-2) (Swiss-Prot:P55162) [Drosophila melanogaster]; weak similarity to Nck-associated protein 1 (NAP 1) (p125Nap1) (Membrane-associated protein HEM-2) (Swiss-Prot:P55161) [Rattus norvegicus] Length = 1339 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 449 DTPAVMPPMIEDVFSAVVFITDSVFWY 369 D P+++ P I+ VFSA+ V WY Sbjct: 417 DQPSLLAPNIQMVFSALALAQSEVLWY 443 >At1g78270.1 68414.m09121 UDP-glucose glucosyltransferase, putative similar to UDP-glucose glucosyltransferase GI:3928543 from [Arabidopsis thaliana] Length = 489 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/65 (24%), Positives = 35/65 (53%) Frame = +1 Query: 241 FENCTQSKIRQSSDLKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSS 420 F+ +I ++S++ RKLG+ +W+E TE ++ +++ +Y S+ T+E+ Sbjct: 258 FQILENREIDKNSEI-RKLGLNLWEEETESLDWLDTKAEKAVIYVNFGSLTVLTSEQILE 316 Query: 421 IIGGI 435 G+ Sbjct: 317 FAWGL 321 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 42 HSFHTVRVFHCKI*AVFKQLKKQCQ 116 H TV VF+C I V K+LKKQ Q Sbjct: 885 HPNSTVGVFYCGIQTVAKELKKQAQ 909 >At4g10270.1 68417.m01688 wound-responsive family protein similar to wound induced protein (GI:19320) [Lycopersicon esculentum] Length = 90 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +1 Query: 283 LKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSS 420 LK +LG+ W I VNQ L+N S K S +A TSS Sbjct: 20 LKDQLGLCRWNYILRSVNQHLRNNVRSVSQGKRFSSSSVSAAVTSS 65 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 28.3 bits (60), Expect = 6.8 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = +3 Query: 309 VERDHRGRQS--GFEKRQRKPSIPKN*ICDKNDRRE-DVFDHRRHHGRRVQQARSDAQLG 479 +ER HR R+ E R+ + DK RRE D DHR H + ++ D + G Sbjct: 437 LERKHRERKERESREDEDRRRRRRREESRDKESRRERDEDDHRSHRDYKERRRERDDRHG 496 Query: 480 VFPLHRRTRR 509 H R R Sbjct: 497 REARHERRDR 506 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,611,262 Number of Sequences: 28952 Number of extensions: 328617 Number of successful extensions: 1036 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1950880000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -