BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021831 (778 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 5.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.5 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 7.3 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 9.7 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.7 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 9.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.7 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/56 (21%), Positives = 24/56 (42%) Frame = -2 Query: 273 THDRRCLAIKTSSYLCQLLFIFFVSLNIYQGQRYDGFEVWIMFRSFWISTFALTVS 106 T R A+ + ++C F L +Y+ YD W+ + + F+ T++ Sbjct: 257 TITRMLSAVVITFFICWAPFHVQRLLYVYEDSTYDDINQWVYPLTGCLYYFSTTIN 312 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 596 SDDESSITRSEDTDTPEPKST 658 S SSI+ SE+ D +PK T Sbjct: 372 SSSSSSISSSEENDFWQPKPT 392 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 608 SSITRSEDTDTPEPKSTEKSS 670 +S+T +D EP ST K S Sbjct: 264 NSVTCDRPSDEAEPSSTSKKS 284 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 497 VWKPQNAELWKAKFAEAQEIVRTKCSLYCQDQSSDDESSIT 619 + K + E+ + K + +I TKC +C Q +S T Sbjct: 45 ITKDEYDEIGRLKRTCSGDISVTKCEGFCNSQVQPSVASTT 85 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 424 SDPQCTFILISGVMK*LAHTFRVLSLLITTRTVL 323 S + T IL++GV+ +TF +L+ T +L Sbjct: 549 SGRELTIILLAGVLVCYLNTFLLLATPTTVTCIL 582 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 497 VWKPQNAELWKAKFAEAQEIVRTKCSLYCQDQSSDDESSIT 619 + K + E+ + K + +I TKC +C Q +S T Sbjct: 45 ITKDEYDEIGRLKRTCSGDISVTKCEGFCNSQVQPSVASTT 85 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 424 SDPQCTFILISGVMK*LAHTFRVLSLLITTRTVL 323 S + T IL++GV+ +TF +L+ T +L Sbjct: 639 SGRELTIILLAGVLVCYLNTFLLLATPTTVTCIL 672 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,527 Number of Sequences: 438 Number of extensions: 3612 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -