BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021830 (827 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 5e-21 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 27 0.67 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 31 1.5 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) 30 2.0 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 29 3.5 SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 29 4.6 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect = 5e-21 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +1 Query: 40 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 219 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 70.5 bits (165), Expect = 2e-12 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +3 Query: 318 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 497 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 498 VK 503 VK Sbjct: 703 VK 704 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 26.6 bits (56), Expect(2) = 0.67 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +2 Query: 104 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKI*RY 265 +PC ++ C + +S+ V ++K P P TL ++G + +KI +Y Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVKY 451 Score = 23.8 bits (49), Expect(2) = 0.67 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 86 PGPQPPSPCNVRP 124 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 53 TSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVH-ARLLKCPH 187 T+K HT++P T P P N+ P + + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 5 HISFLTVVKFKTQQWVTSKTHTSRPETPGPQPPSPCNVRPC 127 H L K KT + T+K +T++P T P+ P +PC Sbjct: 92 HTIKLYTTKPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +2 Query: 41 QQWVTSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKP 196 +Q V S P P P PP+PC + PC +T +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) Length = 975 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -3 Query: 438 CRS-QYATVCRGHHPEF*GPHAGHRCQPSGSGSHHPRYQSV-GSLRASRGVRPC 283 CRS Q TV HH HRC+ SG+H R+ ++ L RPC Sbjct: 241 CRSLQVQTVINAHHTVRNVCDICHRCRKGCSGNHDNRFGAIQARLLGGLAPRPC 294 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 130 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNGKNMKISVPPH 279 + G +M +G+PCKI + K G HG +H+ G D NG +S PH Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG---CVSAGPH 62 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -2 Query: 520 VESCFALTAMTHSS----PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIR 353 V C L A++ S P+ S V + +LP+ V C+P SPS I RS P Sbjct: 235 VVECGGLRAISECSDPYPPRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISN 293 Query: 352 VR 347 VR Sbjct: 294 VR 295 >SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -3 Query: 297 GVRPCCVWRDRYLHIFTIEDINPNQVNFSVAVLSGFGCGHFNNLAWTTLQHNETVFTQ 124 G+R C D L +F + + + S A ++ +G GH N + L H + TQ Sbjct: 243 GLRSCITHGDDLLSVFDNMESSSKVFDMSNAPVTRYGLGHVNQILEEELSHLRFLKTQ 300 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 20 TVVKFKTQQWVTSKTHTSRPETPGPQPPSPCNVRP 124 +VV + VT K T +P TP P P P RP Sbjct: 758 SVVAMPAARPVTPKPVTPKPVTPKPVTPKPVTTRP 792 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,040,513 Number of Sequences: 59808 Number of extensions: 596465 Number of successful extensions: 1735 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1724 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -