BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV021829
(771 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
06_01_0114 - 892599-893070,894115-894457,894896-895151 30 2.4
>06_01_0114 - 892599-893070,894115-894457,894896-895151
Length = 356
Score = 29.9 bits (64), Expect = 2.4
Identities = 18/64 (28%), Positives = 28/64 (43%)
Frame = -3
Query: 484 DLRMNEENHNTTHRKRSFTSFTCTKLYAHHFLYNITRYDASLSKKPDQFPGRVEGVEGVR 305
DL + H++ SF + Y HH +++ Y A KK D P R +G +
Sbjct: 52 DLLLPIRPHSSAAATYSFANPAAAPFYHHHHHPSLSYY-AYYGKKLDPEPWRCRRTDGKK 110
Query: 304 WQFS 293
W+ S
Sbjct: 111 WRCS 114
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,192,689
Number of Sequences: 37544
Number of extensions: 363653
Number of successful extensions: 735
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 717
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 735
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2075009728
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -