Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021829
         (771 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK124181-1|BAC85796.1|  124|Homo sapiens protein ( Homo sapiens ...    32   2.6  

>AK124181-1|BAC85796.1|  124|Homo sapiens protein ( Homo sapiens
           cDNA FLJ42187 fis, clone THYMU2032358. ).
          Length = 124

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
 Frame = -3

Query: 502 LLQEQSDLRMNEENHNTTHRKRSFTSFTCTKLYAHH---FLYNITRYDASLSKKPDQFPG 332
           LL+ +S  ++ E NH   HR+ S   F C  L   H   +L ++T+   S  + P    G
Sbjct: 48  LLEGRSTEQIQERNHCVFHRRESTLDFLCNLLLHFHRDSYLCSVTQLKPSKIRLPCLHKG 107

Query: 331 RVEG 320
             +G
Sbjct: 108 HHDG 111


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,656,957
Number of Sequences: 237096
Number of extensions: 2033965
Number of successful extensions: 3397
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3340
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3397
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9311505506
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)