BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021826 (837 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U77947-1|AAB41404.1| 2416|Drosophila melanogaster adenomatous po... 30 3.4 AE014297-4275|AAF56820.1| 2417|Drosophila melanogaster CG1451-PA... 30 3.4 AE014297-2568|AAF55584.1| 950|Drosophila melanogaster CG7709-PA... 30 3.4 AY061451-1|AAL28999.1| 249|Drosophila melanogaster LD38807p pro... 29 7.9 >U77947-1|AAB41404.1| 2416|Drosophila melanogaster adenomatous polyposis coli protein. Length = 2416 Score = 30.3 bits (65), Expect = 3.4 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = -3 Query: 331 APADIIDRAPLPPNRVSNETMKVVVFSDDRAKRSPTYATXLMSPYNARLESSSTGSSFPA 152 APA + + + +N ++V V A+ SPT+ S + ++S GS A Sbjct: 2220 APARLERQGTFVKDEPTNSNVQVPVVETKPAQTSPTHRA---SKLPTKKGTASGGSPSKA 2276 Query: 151 DSPKPVPLA 125 SPK +PLA Sbjct: 2277 GSPKRIPLA 2285 >AE014297-4275|AAF56820.1| 2417|Drosophila melanogaster CG1451-PA protein. Length = 2417 Score = 30.3 bits (65), Expect = 3.4 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = -3 Query: 331 APADIIDRAPLPPNRVSNETMKVVVFSDDRAKRSPTYATXLMSPYNARLESSSTGSSFPA 152 APA + + + +N ++V V A+ SPT+ S + ++S GS A Sbjct: 2221 APARLERQGTFVKDEPTNSNVQVPVVETKPAQTSPTHRA---SKLPTKKGTASGGSPSKA 2277 Query: 151 DSPKPVPLA 125 SPK +PLA Sbjct: 2278 GSPKRIPLA 2286 >AE014297-2568|AAF55584.1| 950|Drosophila melanogaster CG7709-PA protein. Length = 950 Score = 30.3 bits (65), Expect = 3.4 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 2/104 (1%) Frame = -3 Query: 442 SQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNE--TM 269 S +P A S R+ A +V A S + +G + P + P P R S++ Sbjct: 83 SSSPGEAASVMRVQLFGVIAVAVVAVSLVRDVGAE--PPVNNAYLPPSSPQRPSSKYGAP 140 Query: 268 KVVVFSDDRAKRSPTYATXLMSPYNARLESSSTGSSFPADSPKP 137 V + + +P++ + S Y A +S+S+G +PA +P+P Sbjct: 141 PVSSYLPPASGPAPSFNSAPSSSYAAPSQSASSGGPYPAAAPRP 184 >AY061451-1|AAL28999.1| 249|Drosophila melanogaster LD38807p protein. Length = 249 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -2 Query: 245 SRETISHLCYTSHVSL---QCQTRVKLNRVFFPR*FSQARSLGC 123 S+ TI CY ++S QCQ R+ +VFF S A C Sbjct: 14 SKRTIFETCYMKNISFLKTQCQARILFCKVFFAVHSSNANVPSC 57 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,812,999 Number of Sequences: 53049 Number of extensions: 857053 Number of successful extensions: 2850 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2850 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3983256888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -