BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021821X (499 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1W3U0 Cluster: General secretion pathway L precursor; ... 33 4.7 UniRef50_UPI000058892D Cluster: PREDICTED: hypothetical protein;... 32 6.2 >UniRef50_A1W3U0 Cluster: General secretion pathway L precursor; n=4; Comamonadaceae|Rep: General secretion pathway L precursor - Acidovorax sp. (strain JS42) Length = 409 Score = 32.7 bits (71), Expect = 4.7 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 471 HGPFSLVLVLSIAGSSAVASRPASGAP 391 HGP V VL +A ++A+A+RPA AP Sbjct: 169 HGPQQAVAVLPLAAAAALAARPADDAP 195 >UniRef50_UPI000058892D Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 285 Score = 32.3 bits (70), Expect = 6.2 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 350 DYTGLKIQVLQGGNGAPEAGRDATAEDPAMDSTKTK---EKGPWNK 478 DY+GLKIQ LQ + P + D + KTK GPWN+ Sbjct: 107 DYSGLKIQALQVTDEPPVGEEEEEEVDENGEIIKTKGQGASGPWNR 152 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 363,484,405 Number of Sequences: 1657284 Number of extensions: 5273739 Number of successful extensions: 16477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16475 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29273652170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -