BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021821X (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_21143| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.42) 27 6.5 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = -2 Query: 465 PFSLVLVLSIAGSSAVASRPASGAPLPPCST*ILSPV 355 PF+++ ++SI G+SA++S L CS +++P+ Sbjct: 378 PFTIMQIMSIKGTSAMSSDTVFSVLLIQCSNSLVNPI 414 >SB_21143| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.42) Length = 870 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 410 RDATAEDPAMDSTKTKEKG 466 R A+++ PAMDST K+KG Sbjct: 115 RPASSQTPAMDSTSGKDKG 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,197,514 Number of Sequences: 59808 Number of extensions: 162387 Number of successful extensions: 400 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -