BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021820 (752 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.1 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 7.1 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 406 LPRDVGHYVHSISTTDTNTQSTKATS 329 LP+ + YVH I T +ATS Sbjct: 528 LPKGIDEYVHRIGRTGRVGNRGRATS 553 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 655 LKSTGRHDIAATANSYKHLLT 717 LKS D+A A S HLLT Sbjct: 746 LKSPEWKDLAKKARSVNHLLT 766 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 431 VKLTGKLTGWTSPKDVILKVAG-ILTVREVPA 523 +KL G + W SP ++ +AG I+++ + A Sbjct: 276 MKLVGIIIMWYSPFGIMCLIAGKIMSINNLTA 307 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,668 Number of Sequences: 438 Number of extensions: 5376 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -