BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021819 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 3.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 3.9 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 6.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/44 (25%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 240 CPNTYVPDHEYCETTAQTP-SQRQAITELAPTQPAVDEEEETPE 368 C + + DH +T Q P Q+Q + P Q + +++ P+ Sbjct: 1487 CDSKLIVDHSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQQQPQ 1530 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +1 Query: 67 ENLNSYSHQNIKIYNQCWKGDVNHSVVVMATLIQENGIKELSK 195 E L S+ + ++ QCW G+ + ++ A + I++ +K Sbjct: 822 ERLPSFDDECWRLMEQCWSGEPSKRPLLGAIVPVLESIQQKAK 864 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +1 Query: 67 ENLNSYSHQNIKIYNQCWKGDVNHSVVVMATLIQENGIKELSK 195 E L S+ + ++ QCW G+ + ++ A + I++ +K Sbjct: 860 ERLPSFDDECWRLMEQCWSGEPSKRPLLGAIVPVLESIQQKAK 902 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 214 PLPRGCPCSAL 182 PLP GCP +A+ Sbjct: 215 PLPLGCPVNAI 225 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 375 IMINNVVCSFSVKCHLNLRQIXLN 446 I +NN+ S+ +KC + + LN Sbjct: 49 IKLNNIPKSYGIKCEIYAKCEFLN 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,978 Number of Sequences: 438 Number of extensions: 3815 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -