BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021816X (536 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 23 1.5 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 22 3.5 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 22 3.5 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 22 3.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 6.0 AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 21 8.0 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 8.0 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 350 SVHNWHHFSHVIRDETVEQMLIA 282 SVH+ HH V RD E +L+A Sbjct: 21 SVHHCHHNGVVHRDLKPENLLLA 43 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 220 LSIDRYENPLNNTSILWGSW 279 LS+D Y+N L+ L G W Sbjct: 159 LSMDGYQNILDKKDELLGEW 178 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 220 LSIDRYENPLNNTSILWGSW 279 LS+D Y+N L+ L G W Sbjct: 159 LSMDGYQNILDKKDELLGEW 178 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 220 LSIDRYENPLNNTSILWGSW 279 LS+D Y+N L+ L G W Sbjct: 159 LSMDGYQNILDKKDELLGEW 178 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 194 KRSRLNYASSRSTDTKIHLTIHLSYG 271 K SR+ STD H ++ S+G Sbjct: 673 KDSRIKTTEKLSTDPNTHFQVNQSHG 698 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 6.0 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = -1 Query: 110 PGCLRWSRPERPLV 69 P +W P RP+V Sbjct: 837 PNLTKWGNPNRPIV 850 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 21.0 bits (42), Expect = 8.0 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 535 ACAQVAQTQIRSPSVTTMARTSVSGQFLRTSYTCPLS 425 AC + R+ SVT+M + G T C +S Sbjct: 115 ACGFIDNIDKRNLSVTSMIQKRALGPSFSTGERCRIS 151 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.0 bits (42), Expect = 8.0 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 426 DKGHVYDVLKNW 461 D+ YDVL++W Sbjct: 260 DQSETYDVLRSW 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,313 Number of Sequences: 438 Number of extensions: 4277 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -