BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021813 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 24 1.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.8 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 5.8 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 268 SLCTWKYSTW*FRNFVFFVGTFA--LSHFATAYSS 170 +LC S + F+NF+F + TF+ ++ F Y S Sbjct: 223 NLCQVANSIYGFQNFLFVLSTFSICITQFYYCYDS 257 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 553 IRLEMHMEQVFLDTVDAYVWIYDPKPW 633 I+ E+++ DT+ +VWI+ PW Sbjct: 525 IQAEVNIWNPLTDTIPIHVWIH---PW 548 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 203 ECTNEEDKISKSPRGIFPGTKAVDALLTSK 292 EC E ++K+ R +FP K A L K Sbjct: 42 ECLTNEMIVTKNGRRMFPVVKVTAAGLDPK 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,979 Number of Sequences: 336 Number of extensions: 2990 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -