BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021813 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 7.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 7.2 AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 23 9.5 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 9.5 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 178 YSSLV--GFSDSGGSPKSSLRFLVFLLSAIVC 89 Y +LV G+ DS G P SL ++ L +VC Sbjct: 2167 YDALVSAGYLDSQGRPLKSLYLMLELRLPLVC 2198 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 178 YSSLV--GFSDSGGSPKSSLRFLVFLLSAIVC 89 Y +LV G+ DS G P SL ++ L +VC Sbjct: 2168 YDALVSAGYLDSQGRPLKSLYLMLELRLPLVC 2199 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 23.0 bits (47), Expect = 9.5 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 654 SGRLWNDHS 680 SGR WNDH+ Sbjct: 79 SGRFWNDHT 87 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 339 LITCIVCFCINSSTGPRRSL 398 L+ IV FC+ S GP+ L Sbjct: 346 LLVAIVDFCVGSLWGPKSEL 365 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,559 Number of Sequences: 2352 Number of extensions: 11546 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -