BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021809 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 36 0.002 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 1.8 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 5.5 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 5.5 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 5.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 5.5 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 5.5 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 5.5 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 5.5 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 5.5 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 5.5 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 5.5 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 5.5 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 5.5 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 7.2 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 7.2 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 7.2 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 7.2 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 7.2 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 23 7.2 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 35.5 bits (78), Expect = 0.002 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 28 KATPENIARAKIIIDRLEANGGTNIDAALGTAIDLIRNRSE 150 +ATP+N+ K I+ +E N AAL TA +L+R ++ Sbjct: 327 RATPDNVKEVKTAINAVECENTANFSAALETAFELLRKYNQ 367 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 418 CSCATSTDRSPRLCCHMSNLSTHRIR*SRAGYQDQVP 528 C C + C H + S++ + SRAGY D++P Sbjct: 752 CDCKMECPKQCT-CYHDQSWSSNVVDCSRAGYDDRLP 787 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 142 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 175 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 151 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRPE 143 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 146 QSFLPIQHLPTKMKSCLWSPSSYS*RMAIRLS 241 Q F+ QH P ++++C W +S + R I ++ Sbjct: 267 QKFVCHQHEPQEIRTCHWGFNSSNWRSYIHVA 298 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 382 KPLLRSDSLRKSLGSASSPKASENIVA 302 KP+L D +S+ A PK+ E VA Sbjct: 113 KPVLMMDGAPRSVVKAKHPKSQERKVA 139 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 109 ALGTAIDLIRNRSELFANSTSSNKDEILSLEP 204 A+G A+ L N S+ F +STSS +I+ P Sbjct: 272 AMGLAMVLDANASDYFCSSTSSVGFKIIFHSP 303 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 109 ALGTAIDLIRNRSELFANSTSSNKDEILSLEP 204 A+G A+ L N S+ F +STSS +I+ P Sbjct: 272 AMGLAMVLDANASDYFCSSTSSVGFKIIFHSP 303 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 622 IAAEASTVDSRSRVAVIDLPGDHHLG-PRVVRTE 524 + + S +DS ++D DHH G VVR E Sbjct: 118 VHGQYSLLDSDGHHRIVDYHADHHTGFNAVVRRE 151 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 543 GPRWWSPGRSITATRDLESTVEASAAMR 626 G RWW+P +I A + +VEA+ R Sbjct: 9 GSRWWAPAMAILA---VALSVEAAEVAR 33 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 703,803 Number of Sequences: 2352 Number of extensions: 14389 Number of successful extensions: 53 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -