Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021806
         (702 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ...    25   1.7  
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    23   7.0  

>M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 1222

 Score = 25.4 bits (53), Expect = 1.7
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = -1

Query: 687 VPKWYLSNTPGSPTACSCGVIFQMSTRPSSDQLAANTEFLKFVALILFTHP 535
           + + + S   G   A   GV+F     P S  LA    FL+ + L  F+HP
Sbjct: 77  IQRVWCSEAQGLVAAQIGGVVFISCYAPPSLNLAEFERFLEAIELEGFSHP 127


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 257 CDAASGSNWSPM 292
           C + SG +WSPM
Sbjct: 735 CSSVSGGDWSPM 746


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 664,565
Number of Sequences: 2352
Number of extensions: 12619
Number of successful extensions: 16
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71504505
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)