BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021806 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 1.7 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 7.0 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 25.4 bits (53), Expect = 1.7 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -1 Query: 687 VPKWYLSNTPGSPTACSCGVIFQMSTRPSSDQLAANTEFLKFVALILFTHP 535 + + + S G A GV+F P S LA FL+ + L F+HP Sbjct: 77 IQRVWCSEAQGLVAAQIGGVVFISCYAPPSLNLAEFERFLEAIELEGFSHP 127 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 257 CDAASGSNWSPM 292 C + SG +WSPM Sbjct: 735 CSSVSGGDWSPM 746 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,565 Number of Sequences: 2352 Number of extensions: 12619 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -