BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021797 (602 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC032846-1|AAH32846.2| 304|Homo sapiens developmental pluripote... 31 3.1 AK001575-1|BAA91765.1| 294|Homo sapiens protein ( Homo sapiens ... 31 3.1 >BC032846-1|AAH32846.2| 304|Homo sapiens developmental pluripotency associated 4 protein. Length = 304 Score = 31.1 bits (67), Expect = 3.1 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 414 DVSLQETEFHPPTARFHAVNEPSVEHNSAAYIAQSNSLL 298 + SLQ +E HPP V EP NS A + N+++ Sbjct: 155 ETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVV 193 >AK001575-1|BAA91765.1| 294|Homo sapiens protein ( Homo sapiens cDNA FLJ10713 fis, clone NT2RP3000980. ). Length = 294 Score = 31.1 bits (67), Expect = 3.1 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 414 DVSLQETEFHPPTARFHAVNEPSVEHNSAAYIAQSNSLL 298 + SLQ +E HPP V EP NS A + N+++ Sbjct: 145 ETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVV 183 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,961,513 Number of Sequences: 237096 Number of extensions: 1496549 Number of successful extensions: 3684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3676 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6354183230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -