BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021796 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 3.9 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -3 Query: 480 GQPPRVGSRSSRTS-NSPRATVDPKPSRDTAR*SLCCTQRIS 358 G+PP V SRS++TS N+ + T AR ++ T++++ Sbjct: 982 GKPPSVVSRSTQTSANNDKDTNAVVTQSKEARDNITATKQLN 1023 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -3 Query: 501 WR-ACIECGQPPRVGSRSSRTSNSPRATVDPK 409 W+ +C+ C PPR S + S R P+ Sbjct: 385 WQMSCVACSPPPRQTPPSRKESGRRRRRRTPR 416 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,016 Number of Sequences: 438 Number of extensions: 3498 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -