BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021794X (523 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|... 36 0.004 SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyce... 27 1.7 SPAC823.06 |taf3||transcription factor TFIID complex subunit Taf... 27 2.2 SPAC23A1.08c |rpl3401|rpl34, rpl34-1|60S ribosomal protein L34|S... 25 6.8 SPCC1919.09 |tif6||translation initiation factor eIF6|Schizosacc... 25 9.0 >SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 35.9 bits (79), Expect = 0.004 Identities = 20/82 (24%), Positives = 36/82 (43%) Frame = +3 Query: 201 STSQRVCCRAAGIEKT*FSLCKQVTDSSLGRIAQSLKNLEELELGGCCNITDTGLLLIAW 380 S + + C+ + + S C +TDSSL + + ++L L LG C ITD G+ + Sbjct: 267 SDIELITCKFSKLNSLFLSKCIGLTDSSLLSLTKLSQSLTTLHLGHCYEITDIGVQCLLK 326 Query: 381 GXXXXXXXXXXSCWHVNDAGIA 446 C ++D ++ Sbjct: 327 SCKNITYIDFGGCLRLSDIAVS 348 Score = 32.3 bits (70), Expect = 0.045 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 261 CKQVTDSSLGRIAQSLKNLEELELGGCCNITDTGLLLIA 377 C ++TD + + +S KN+ ++ GGC ++D + IA Sbjct: 313 CYEITDIGVQCLLKSCKNITYIDFGGCLRLSDIAVSAIA 351 Score = 25.4 bits (53), Expect = 5.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 294 IAQSLKNLEELELGGCCNITDTGLLLI 374 I+ + NL+ L +G C + DTG++ I Sbjct: 141 ISDNCPNLKALNIGNCGLVEDTGMVQI 167 >SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyces pombe|chr 3|||Manual Length = 563 Score = 27.1 bits (57), Expect = 1.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 261 CKQVTDSSLGRIAQSLKNLEELELGGCCNITD 356 C ++T SL +IAQ NL+ L L C + D Sbjct: 251 CSKITADSLFQIAQYCPNLQTLHLTYCGQMQD 282 >SPAC823.06 |taf3||transcription factor TFIID complex subunit Taf3|Schizosaccharomyces pombe|chr 1|||Manual Length = 155 Score = 26.6 bits (56), Expect = 2.2 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +3 Query: 225 RAAGIEKT*FSLCKQVTDSSLGRI-AQSLKNLEELELG--GCCNITDTGLLL 371 RAAGI++T SL TD ++ I S + + E+G CC++ D L + Sbjct: 23 RAAGIDRTKVSLLNSFTDITIRYIRLLSETAMAKAEVGRRSCCDLGDLRLAM 74 >SPAC23A1.08c |rpl3401|rpl34, rpl34-1|60S ribosomal protein L34|Schizosaccharomyces pombe|chr 1|||Manual Length = 112 Score = 25.0 bits (52), Expect = 6.8 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -1 Query: 499 PKCSSSGVPLASPPQHRWAIPASLTCQHDRRFNRRRF---LSPHAINSRPVSVML 344 P+C +GVPL P R A L+ H+++ +R + LS +A+ R V L Sbjct: 42 PRCGDTGVPLQGIPALRPREFARLS--HNKKTVQRAYGGCLSANAVKDRIVRAFL 94 >SPCC1919.09 |tif6||translation initiation factor eIF6|Schizosaccharomyces pombe|chr 3|||Manual Length = 244 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 345 CSNRLALVLPSSLTIERFFRVKSPLP 268 C NR L++PSS T +++ LP Sbjct: 64 CGNRKGLLVPSSTTDNELQHLRNSLP 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,991,694 Number of Sequences: 5004 Number of extensions: 35242 Number of successful extensions: 89 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -