BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021792 (772 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 22 7.3 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 22 7.3 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.6 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 21 9.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.6 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 211 KDRYLKTLSRIRLN*KPRCCSNSE 282 +D +LKT R+ KP CS+ + Sbjct: 21 RDHHLKTHMRLHTGEKPYHCSHCD 44 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.8 bits (44), Expect = 7.3 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +2 Query: 143 WSNSRCKHS*QKSFRLRFERHQRRI 217 W + K+ K FR++FE +++ Sbjct: 102 WDSLANKYDPDKKFRVKFEEEAKKL 126 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/37 (24%), Positives = 16/37 (43%) Frame = +2 Query: 410 SINTPPGTKLLLKNEELEVCHGVVWLTPSVISVWAEQ 520 S+N+ K + L H +TP I+ W ++ Sbjct: 410 SVNSTSSPKPFPRRATLAQLHNFTTMTPQEIAQWIDR 446 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 659 NCLSTERASNLCPNGIHGG 603 NC++ N+ P GIH G Sbjct: 54 NCITVCNMENVDPLGIHTG 72 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 772 PPPKPFSHQTSSVPQQ 725 P P+P HQ+ PQ+ Sbjct: 21 PGPQPSPHQSPQAPQR 36 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,626 Number of Sequences: 438 Number of extensions: 4594 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -