BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021791 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 4e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 8e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 47 1e-05 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) 42 6e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_4962| Best HMM Match : FAD_binding_4 (HMM E-Value=5.7e-31) 29 2.8 SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.7 SB_53943| Best HMM Match : PsbQ (HMM E-Value=1.5) 29 4.9 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 29 4.9 SB_58033| Best HMM Match : HSA (HMM E-Value=3.2) 28 6.4 SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) 28 6.4 SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 68 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 46 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 68 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 46 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 68 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 125 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 170 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +2 Query: 68 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 46 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 89 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +1 Query: 289 GASVG-----ADLGGSSKYSSEALED*RGEGF 369 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 61 GASLGETASSADLGGSSKYSNESFEDRSGERF 92 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 89 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 89 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 52.4 bits (120), Expect = 3e-07 Identities = 30/59 (50%), Positives = 35/59 (59%) Frame = -1 Query: 404 DRLTREQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGSRPDPSALSSRTSYSLRL 228 DRLT QLLFT N SP +SS+ S EYLLLPPRSA + +R + SYS L Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEYLLLPPRSALEAVFTQARARGCVTTPTPSYSSEL 147 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +1 Query: 289 GASVG-----ADLGGSSKYSSEALED*RGEGF 369 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 95 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 187 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 46 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 98 SAKECATTHLPKQPALKMDGAEAFCLYTTV 187 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 98 SAKECATTHLPKQPALKMDGAEAFCLYTTV 187 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 98 SAKECATTHLPKQPALKMDGAEAFCLYTTV 187 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 98 SAKECATTHLPKQPALKMDGAEAFCLYTTV 187 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 40 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 101 AKECATTHLPKQPALKMDGAEAFCLYTTV 187 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 15 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 107 + +RS D KGVG S QQDGGHGS NP + Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 73 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 118 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 15 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 122 + +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -3 Query: 384 TTVHAKPFSTSVLQGLAGVFATTTKICTDG 295 T VH +PFSTSV + L +FATTTKICT G Sbjct: 113 TAVHMEPFSTSVFKALIRIFATTTKICTGG 142 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 104 KECATTHLPKQPALKMDGAEAFCLYTTV 187 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +3 Query: 15 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 107 + +RS D KGVG S QQDGGHGS NPL+ Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 Score = 37.1 bits (82), Expect = 0.014 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 247 VREESAEGSGREPLGASVG-----ADLGGSSKYSSEALED*RGEGF 369 +R G GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 73 LRRVGGRGGRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 118 >SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) Length = 164 Score = 41.5 bits (93), Expect = 6e-04 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 7/47 (14%) Frame = -3 Query: 384 TTVHAKPFSTSVLQGLAGVFATTTKICTDG----GSKR---LTPRPF 265 T VH PFSTS Q L +FATTTKIC G GS + TP PF Sbjct: 48 TAVHMDPFSTSGFQALILIFATTTKICPGGRFTQGSGKGWVTTPTPF 94 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 28 NAHGTP*KALVAHDSRTVAMEVGIR 102 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +2 Query: 89 KSESAKECATTHLPKQPALKM 151 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 34.7 bits (76), Expect = 0.074 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 176 IGKTLQRHPFSGLVASA 126 IG TL+RHPFSGLVASA Sbjct: 24 IGATLERHPFSGLVASA 40 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 34.7 bits (76), Expect = 0.074 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 176 IGKTLQRHPFSGLVASA 126 IG TL+RHPFSGLVASA Sbjct: 22 IGATLERHPFSGLVASA 38 >SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +2 Query: 296 PSVQILVVVANTPARPWRTDVEKG 367 P VQILVVVAN R +T+VEKG Sbjct: 39 PPVQILVVVANIQMRALKTEVEKG 62 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -2 Query: 457 KNYKKTRHIDIRSLLELRID*LASNYCSRETLLHVSPPGPRWS 329 +N K RH+ + D L+SN CS L + P PRWS Sbjct: 2 ENNKTVRHLGRHFTGHAKNDALSSNSCSPGDPLVLERPPPRWS 44 >SB_4962| Best HMM Match : FAD_binding_4 (HMM E-Value=5.7e-31) Length = 916 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/61 (24%), Positives = 27/61 (44%) Frame = +2 Query: 254 RRAQKGLGVSRLEPPSVQILVVVANTPARPWRTDVEKGFA*TVVARESVDPKLKERSYVD 433 RR LG + + PP + + V+ A WR + F+ V P++K ++ + Sbjct: 510 RRCLASLGYTCITPPRIPVRVITAFGHKTRWRPPARRDFSSEVELTSIRYPQIKRGAFAE 569 Query: 434 V 436 V Sbjct: 570 V 570 >SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1468 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -1 Query: 371 RNPSPRQSSRASLEYLLLPPRSAP--TEAPSGSRPDPSALSSRTSYSLRLNDTKLKI 207 R+P+P + + ++ PPR+ P T P + P+P+ SRT L ++ + Sbjct: 345 RDPNPNVHTTDAPKHTTEPPRTTPEPTTEPPQTTPEPTTEPSRTKPELTTEPSRTTV 401 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -1 Query: 371 RNPSPRQSSRASLEYLLLPPRSAP--TEAPSGSRPDPSALSSRTSYSLRLNDTKLKI 207 ++P+P + +L+ PPR+ P T P + P+P+ SRT+ L ++ + Sbjct: 710 KDPNPNVHTTDALKPTTEPPRTTPEPTTEPPRTTPEPTTEPSRTTPELTTEPSRTTV 766 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 120 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 25 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_53943| Best HMM Match : PsbQ (HMM E-Value=1.5) Length = 540 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 82 PPSCCHERPTPFMVSHERFLGALGTT 5 PP C ERP+ F++ GAL TT Sbjct: 332 PPILCSERPSSFVIGANGSAGALPTT 357 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 359 PRQSSRASLEYLLLPPRSAPTEAPSGSRPDP 267 PR +S++S+ + PP S P AP+ +P P Sbjct: 165 PRTTSQSSIPGVAPPPSSQPAPAPAPPQPAP 195 >SB_58033| Best HMM Match : HSA (HMM E-Value=3.2) Length = 249 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 596 LQATLGYPVEHSFLKTRERLLKRFRCRVPDRNRIPF 489 L TLGYP H+FL+ R R+L +R P + + Sbjct: 41 LSGTLGYPALHTFLE-RFRVLDLYRSYSPSGTAVTY 75 >SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 646 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 238 E*DVREESAEGSGREPLGASVGADLGGSSKYSSEALED*RGEG 366 E D+ + G E +G S GAD+ + K S ++D GEG Sbjct: 270 EGDIVKRPVYGKTLEEIGKSGGADIFYNGKMSKTVVKDINGEG 312 >SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 Query: 310 LGGSSKYSSEALED*RG 360 LGGSSKYS+E+ ED G Sbjct: 2 LGGSSKYSNESFEDRSG 18 >SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1189 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = -1 Query: 365 PSPRQSSRASLEYLLLPPRSAPTEAPSGSRPDPSALSSRTSYSLRLNDTKLKI 207 P+ R + A +LPP + PT P+ + P R + ++D+++++ Sbjct: 477 PTTRLPTTAQTPTTILPPTTTPTPPPTTTEPQRPPDPPRNVQARTISDSEIEV 529 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,914,689 Number of Sequences: 59808 Number of extensions: 498608 Number of successful extensions: 2329 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 2179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2326 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -