BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021786 (658 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|S... 26 5.5 SPBPB10D8.04c |||membrane transporter |Schizosaccharomyces pombe... 25 7.3 SPBPB10D8.05c |||membrane transporter |Schizosaccharomyces pombe... 25 7.3 SPBPB10D8.06c |||membrane transporter |Schizosaccharomyces pombe... 25 7.3 SPBPB10D8.07c |||membrane transporter |Schizosaccharomyces pombe... 25 7.3 SPBC32F12.08c |duo1||DASH complex subunit Duo1 |Schizosaccharomy... 25 9.6 SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomy... 25 9.6 >SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.8 bits (54), Expect = 5.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 177 YWPRDTKSICLSFGTDIDFIEFLE 248 YWP+D ++ FGT+ D I+ + Sbjct: 104 YWPQDLYTLNPHFGTEQDLIDLAD 127 >SPBPB10D8.04c |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 113 TRLSLRISKNRKYNF*ITVSNLLATGYQIYLSIIWN*HRFYRIP 244 TRL+ +I N I SN +A G+ I I+W F+++P Sbjct: 179 TRLNKKIILNTIVTSFICWSNAIALGFCIIACILWR-MIFFKVP 221 >SPBPB10D8.05c |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 113 TRLSLRISKNRKYNF*ITVSNLLATGYQIYLSIIWN*HRFYRIP 244 TRL+ +I N I SN +A G+ I I+W F+++P Sbjct: 179 TRLNKKIILNTIVTSFICWSNAIALGFCIIACILWR-MIFFKVP 221 >SPBPB10D8.06c |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 113 TRLSLRISKNRKYNF*ITVSNLLATGYQIYLSIIWN*HRFYRIP 244 TRL+ +I N I SN +A G+ I I+W F+++P Sbjct: 179 TRLNKKIILNTIVTSFICWSNAIALGFCIIACILWR-MIFFKVP 221 >SPBPB10D8.07c |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 25.4 bits (53), Expect = 7.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 113 TRLSLRISKNRKYNF*ITVSNLLATGYQIYLSIIWN*HRFYRIP 244 TRL+ +I N I SN +A G+ I I+W F+++P Sbjct: 179 TRLNKKIILNTIVTSFICWSNAIALGFCIIACILWR-MIFFKVP 221 >SPBC32F12.08c |duo1||DASH complex subunit Duo1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 166 Score = 25.0 bits (52), Expect = 9.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 309 LGNNFRIIQLWVAMFKVLYHTRGIL*N 229 + N+ R+IQLW ++ HT+ ++ N Sbjct: 40 INNSNRLIQLWSSVLSQTEHTQNLILN 66 >SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomyces pombe|chr 3|||Manual Length = 384 Score = 25.0 bits (52), Expect = 9.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 577 RTVRTMN*IPANVFLYVPNTNTRAQL 654 ++++T N P N +Y P TN + L Sbjct: 183 KSIKTWNYQPKNALMYTPETNHSSSL 208 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,567,023 Number of Sequences: 5004 Number of extensions: 51193 Number of successful extensions: 93 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -