BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021784 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 4e-21 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 31 1.2 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) 30 1.5 SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) 29 3.5 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 29 3.5 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 24 4.2 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 28 6.2 SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24178| Best HMM Match : FARP (HMM E-Value=6.1e-31) 28 6.2 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_45329| Best HMM Match : Protamine_P2 (HMM E-Value=0.63) 28 8.1 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 28 8.1 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect = 4e-21 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +1 Query: 55 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 234 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 66.5 bits (155), Expect = 2e-11 Identities = 28/62 (45%), Positives = 43/62 (69%) Frame = +3 Query: 333 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVMP 512 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 513 SK 518 K Sbjct: 703 VK 704 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 68 TSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVH-ARLLKCPH 202 T+K HT++P T P P N+ P + + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 20 HISFLTVVKFKTQQWVTSKTHTSRPETPGPQPPSPCNVRPC 142 H L K KT + T+K +T++P T P+ P +PC Sbjct: 92 HTIKLYTTKPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +2 Query: 56 QQWVTSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKP 211 +Q V S P P P PP+PC + PC +T +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 532 ESC--VCFDGMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPS 413 +SC +CF S P + H+N+ P S NC P PS Sbjct: 1285 QSCPKICFTSCKPSCPVHCCSEHSNACPQECSTDNCKPSCPS 1326 >SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) Length = 975 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -3 Query: 453 CRS-QYATVCRGHHPEF*GPHAGHRCQPSGSGSHHPRYQSV-GSLRASRGVRPC 298 CRS Q TV HH HRC+ SG+H R+ ++ L RPC Sbjct: 241 CRSLQVQTVINAHHTVRNVCDICHRCRKGCSGNHDNRFGAIQARLLGGLAPRPC 294 >SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) Length = 629 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = +3 Query: 240 GWD*YFNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDG 419 GWD + N + +C ST + + HV +Y+ + L N +ED K+ + Sbjct: 204 GWDMFSNDLDFAKVCSSTQSWRISHV-NINYESVLMRSGEPLCGSMSNKRCKEDEKLVNS 262 Query: 420 DLGT 431 LG+ Sbjct: 263 ALGS 266 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 35 TVVKFKTQQWVTSKTHTSRPETPGPQPPSPCNVRP 139 +VV + VT K T +P TP P P P RP Sbjct: 758 SVVAMPAARPVTPKPVTPKPVTPKPVTPKPVTTRP 792 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 23.8 bits (49), Expect(2) = 4.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 101 PGPQPPSPCNVRP 139 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 Score = 23.4 bits (48), Expect(2) = 4.2 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 119 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLG 247 +PC ++ C + +S+ V ++K P P TL ++G Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIG 440 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 258 NGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNG 386 NG Y CP N D + EDY + D YLT D G Sbjct: 400 NGHTYHMTCPGQTNFDPAKKRCEDYDCSG-RDVAYLTDQNDGG 441 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/82 (23%), Positives = 33/82 (40%) Frame = +3 Query: 285 PSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKE 464 P + + V + +++ D + ADN + RE+ + +L ++ T G Sbjct: 284 PESDGIRVDETENGEHEAVDELPEDKPDTEADNYEQREETPTKEDELKSECTTSDSEGTP 343 Query: 465 LLCTVLKSCGEECVMPSKQTQL 530 T KS GEE V + L Sbjct: 344 SAATYGKSDGEENVAQESEESL 365 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 493 PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIRVR 362 P+ S V + +LP+ V C+P SPS I RS P VR Sbjct: 253 PRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISNVR 295 >SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 28.3 bits (60), Expect = 6.2 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 4/82 (4%) Frame = +3 Query: 300 MDVPHVKREDYQLTDISDDGYLT----LMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 467 +D+P+ K + + L ++DD L+ + D L E L PD + R D G E Sbjct: 37 LDIPYEKYDKFDLESLTDDECLSEFRFIKNDLYRLNEALNFPD-QITCPNRLTVD-GMEA 94 Query: 468 LCTVLKSCGEECVMPSKQTQLS 533 LC L+ C Q+S Sbjct: 95 LCMTLRRFAYPCRYEDLVPQIS 116 >SB_24178| Best HMM Match : FARP (HMM E-Value=6.1e-31) Length = 721 Score = 28.3 bits (60), Expect = 6.2 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 4/85 (4%) Frame = +1 Query: 373 WLTTVTCVRTSKFRMVTSAHS----CVLTSTAARNCCAPC*NPAVRSASCRQSKHSSRQI 540 W VT + VTS H C+ + R C N +R C S H R+I Sbjct: 164 WKICVTSNHKIRKICVTSDHKIRKICITSDHKIRKICVTS-NHKIRKI-CVTSSHKFRKI 221 Query: 541 NQLSIYRVNKLLIFYNQQLLHKCKT 615 S +++ K+ + N ++ C T Sbjct: 222 CVTSDHKIRKICVTSNHKIWKICVT 246 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 145 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVG 246 + G +M +G+PCKI + K G HG +H+ G Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG 50 >SB_45329| Best HMM Match : Protamine_P2 (HMM E-Value=0.63) Length = 474 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 169 GRPCKIVEMSTSKTGKHGHAKVHLVGIDISMVKSMKISVPPHTTWTYPT 315 G+ + M S + G+ K LV IS ++++ +++PPHT PT Sbjct: 421 GQKTRPGRMKKSTSLDSGNVK-RLVDESISAIETVNVALPPHTLKPQPT 468 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 71 SKTHTSRPETPGPQPPSPCNV 133 ++T T++PET P+PP+P + Sbjct: 165 TETTTTKPETKPPKPPAPSTI 185 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,420,894 Number of Sequences: 59808 Number of extensions: 536317 Number of successful extensions: 1571 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1560 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -